KEGG   Frankia symbiont: FsymDg_1002Help
Entry
FsymDg_1002       CDS       T01530                                 

Definition
pyrimidine-nucleoside phosphorylase (EC:2.4.2.4)
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
fsy  Frankia symbiont
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fsy00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    FsymDg_1002
Enzymes [BR:fsy01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     FsymDg_1002
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1174433..1175716
Genome map
AA seq 427 aa AA seqDB search
MTFHVVDLIRTKRDGGRLPDAAVDWLISSYTAGAVPDEQMASYLMAVVWRGMRPAELSRW
TAAMVASGERLDLSGLGRPTVDKHSTGGVGDKVSLVLVPLVVACGAAVPQLAGRGLGHTG
GTLDKMAAIPGWRASLAPERMRSVLTDVGGVIAAAGAGLAPADRKLYALRDVTGTVESIP
LIASSIMSKKIAEGTSALVLDVKVGSGAFMTAQAPARELAETMVALGDVAGVRTEALLTG
MDTPLGRTAGNALEVDEAVAALRGGGPADLVEVTVALARRMLTLAGLAGGPDPADVLAAG
RAHDVWQRMVTAQGGDPDAPLPVAPHVETLPAPATGFLRRLDARAVGLVAWRLGAGRARQ
DDEVSAVAGVRWFAGLGERVVAGAPLLELHTDDPARLATARAALADAVEIADTPPSVQRL
VLDHVHL
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
gtgacttttcacgtcgtcgacctgatccggacgaagcgggacggcggccggctgcccgac
gcggccgtggactggctgatcagctcgtacacggcgggcgccgtccccgacgagcagatg
gcgtcctatctgatggccgtggtgtggcgcggcatgcggccggcggagctgtcccgatgg
accgcggcgatggtcgccagcggcgaacggctcgacctgtccgggcttggccgcccgacc
gtggacaagcactcgaccggcggtgtcggcgacaaggtctcgctggtcctggtgccgctg
gtggtggcctgtggcgcggcggtgccgcagctcgccggccgcgggctcggccacaccggc
gggaccctggacaagatggcggccatccccggctggcgggcctcgctggccccggaacgg
atgcggtcggtgctcaccgacgtcggcggggtcatcgccgccgcgggcgccggcctggcc
ccggcggaccggaagctgtacgcgctgcgggacgtgaccggcacggtcgagtcgatcccg
ctgatcgcctcgtcgatcatgagtaagaagatcgccgaggggacgtccgcgctggtgctg
gacgtcaaggtcggctcgggcgccttcatgacggcccaggcgccggcccgggagctcgca
gagaccatggtcgccctgggtgacgtggccggggtgcgcacggaggcgctgctgaccggc
atggacaccccgctggggcggaccgccggcaacgcgctcgaggtcgacgaggcggtggcg
gccctgcgcggcggcggcccggccgatctggtcgaggtgacggtcgcgctggccaggcgg
atgctcaccctcgccgggctggccggcggcccggacccggcggacgtcctcgcggcgggc
cgggcccacgacgtgtggcaacggatggtcaccgcgcagggcggcgatccggacgcgccc
ctgcccgtggccccgcacgtcgagacactgcccgcgcccgcgaccggtttcctgcgccgg
ctggacgcccgcgccgtcggcctggtggcctggcggctgggggcgggccgggcccgccag
gacgacgaggtgtcggcggtcgcgggcgtgcggtggttcgccggcctcggcgagcgggtc
gtcgccggggcaccgctgctggagctgcacaccgacgacccggcccggctggccaccgcc
cgggcggcgctcgccgacgccgtcgagatcgcggacacgccgccgtccgttcagcggctc
gtcctcgaccacgtccacctgtag

DBGET integrated database retrieval system