KEGG   Frankia symbiont: FsymDg_1002Help
Entry
FsymDg_1002       CDS       T01530                                 

Definition
(GenBank) pyrimidine-nucleoside phosphorylase
  KO
K00758  thymidine phosphorylase [EC:2.4.2.4]
Organism
fsy  Frankia symbiont
Pathway
fsy00240  Pyrimidine metabolism
fsy01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fsy00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    FsymDg_1002
Enzymes [BR:fsy01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     FsymDg_1002
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glycos_transf_3 PYNP_C Glycos_trans_3N
Motif
Other DBs
NCBI-ProteinID: AEH08507
JGI: FsymDg_1002
UniProt: F8AY08
Position
1174433..1175716
Genome map
AA seq 427 aa AA seqDB search
MTFHVVDLIRTKRDGGRLPDAAVDWLISSYTAGAVPDEQMASYLMAVVWRGMRPAELSRW
TAAMVASGERLDLSGLGRPTVDKHSTGGVGDKVSLVLVPLVVACGAAVPQLAGRGLGHTG
GTLDKMAAIPGWRASLAPERMRSVLTDVGGVIAAAGAGLAPADRKLYALRDVTGTVESIP
LIASSIMSKKIAEGTSALVLDVKVGSGAFMTAQAPARELAETMVALGDVAGVRTEALLTG
MDTPLGRTAGNALEVDEAVAALRGGGPADLVEVTVALARRMLTLAGLAGGPDPADVLAAG
RAHDVWQRMVTAQGGDPDAPLPVAPHVETLPAPATGFLRRLDARAVGLVAWRLGAGRARQ
DDEVSAVAGVRWFAGLGERVVAGAPLLELHTDDPARLATARAALADAVEIADTPPSVQRL
VLDHVHL
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
gtgacttttcacgtcgtcgacctgatccggacgaagcgggacggcggccggctgcccgac
gcggccgtggactggctgatcagctcgtacacggcgggcgccgtccccgacgagcagatg
gcgtcctatctgatggccgtggtgtggcgcggcatgcggccggcggagctgtcccgatgg
accgcggcgatggtcgccagcggcgaacggctcgacctgtccgggcttggccgcccgacc
gtggacaagcactcgaccggcggtgtcggcgacaaggtctcgctggtcctggtgccgctg
gtggtggcctgtggcgcggcggtgccgcagctcgccggccgcgggctcggccacaccggc
gggaccctggacaagatggcggccatccccggctggcgggcctcgctggccccggaacgg
atgcggtcggtgctcaccgacgtcggcggggtcatcgccgccgcgggcgccggcctggcc
ccggcggaccggaagctgtacgcgctgcgggacgtgaccggcacggtcgagtcgatcccg
ctgatcgcctcgtcgatcatgagtaagaagatcgccgaggggacgtccgcgctggtgctg
gacgtcaaggtcggctcgggcgccttcatgacggcccaggcgccggcccgggagctcgca
gagaccatggtcgccctgggtgacgtggccggggtgcgcacggaggcgctgctgaccggc
atggacaccccgctggggcggaccgccggcaacgcgctcgaggtcgacgaggcggtggcg
gccctgcgcggcggcggcccggccgatctggtcgaggtgacggtcgcgctggccaggcgg
atgctcaccctcgccgggctggccggcggcccggacccggcggacgtcctcgcggcgggc
cgggcccacgacgtgtggcaacggatggtcaccgcgcagggcggcgatccggacgcgccc
ctgcccgtggccccgcacgtcgagacactgcccgcgcccgcgaccggtttcctgcgccgg
ctggacgcccgcgccgtcggcctggtggcctggcggctgggggcgggccgggcccgccag
gacgacgaggtgtcggcggtcgcgggcgtgcggtggttcgccggcctcggcgagcgggtc
gtcgccggggcaccgctgctggagctgcacaccgacgacccggcccggctggccaccgcc
cgggcggcgctcgccgacgccgtcgagatcgcggacacgccgccgtccgttcagcggctc
gtcctcgaccacgtccacctgtag

DBGET integrated database retrieval system