KEGG   Frankia symbiont: FsymDg_1354Help
Entry
FsymDg_1354       CDS       T01530                                 

Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
fsy  Frankia symbiont
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fsy00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    FsymDg_1354
Enzymes [BR:fsy01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     FsymDg_1354
Exosome [BR:fsy04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   FsymDg_1354
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1592021..1593568
Genome map
AA seq 515 aa AA seqDB search
MGDFVGAIDQGTTSTRFMIFDHDGSEVARRQLEHAQILPRAGWVEHDPVEIWERTAAVVA
AALADAGLGAADLAALGVTNQRETTIVWDPRTGRPYHNAIVWQDTRTDRIVAALERDGRG
QVIRRRSGLPPATYFSAGKIAWILDNVDGVRAAAERGEAVFGTVDSWLLWNLTGGPRGGL
HVTDVTNASRTMLMDLHTLDWDDELLEFFGVPRAILPAIRPSSDPTGYGSTTVSGPLHGE
VALTADLGDQHAATVGQVCFAPGQAKNTYGTGNFLLLNTGPRAVPSQHGLLTTVGYRFGD
DDPVYALEGSIAVTGSAVQWLRDQLGIISSAAESETLAATVPDSGGIYFVPAFSGLFAPY
WRSDARGAVVGLSRFHTGAHLARAALEAICYQSRDVAEAMRLDSGVALDVLRVDGGVTAN
DLCMQTQADILGVPVSRPVVAETTALGAAYAAGLAVGFWKDTGELSTHWREERRFEPRWS
ADRRESGYAGWRKAVERTLNWVDVDPGPDPGPDPG
NT seq 1548 nt NT seq  +upstreamnt  +downstreamnt
atgggcgatttcgtcggggcgatcgaccagggcaccacaagcacccgtttcatgattttc
gatcatgatggcagcgaggtcgcccgccgccagctcgaacacgcccagatcctgccgcgc
gcgggctgggtcgagcacgacccggtggagatctgggagcgcacggccgccgtcgtcgcg
gcggccctggccgacgccggcctcggcgccgcggacctggccgcgctcggcgtcaccaac
cagcgcgagaccacgatcgtgtgggacccgcgcaccggccggccataccacaacgcgatc
gtctggcaggacacccgcaccgaccggatcgtggccgcgctggagcgcgacggccgcggc
caggtgatccggcgccggtccggcctgccaccggcgacctacttctccgcgggcaagatc
gcgtggattctcgacaacgtcgacggggtccgcgccgcggccgaacggggcgaggccgtc
ttcggcaccgtggacagctggctgctgtggaacctcaccggcgggccgcgcggcgggctg
cacgtgacggacgtcaccaacgccagccgcaccatgctgatggacctgcacaccctcgac
tgggacgacgagctgctggagttcttcggcgtcccgcgggcgatactcccggcgatccgg
ccgtcgtccgacccgaccggctacggctcgaccaccgtctccgggccgctgcacggcgag
gtcgcgctgaccgcggacctcggcgaccagcacgccgccaccgtcggacaggtctgcttc
gcccccgggcaggccaagaacacctacggcaccggcaacttcctcctgctgaacaccggc
ccgcgggcggtgccctcccagcacgggctgctcacgacggtcggctaccgcttcggtgac
gacgatccggtgtacgcgctggaaggctcgatcgccgtcaccgggtcggccgtgcagtgg
ctgcgcgaccagctcggcatcatcagcagcgcggccgagagcgaaacgctggccgcgacg
gtgcccgacagcggcgggatctacttcgtcccggccttctccgggctgttcgcgccgtac
tggcgttccgacgcgcggggcgccgtcgtggggctgtcacgcttccacaccggcgcccat
cttgcccgcgccgcgctcgaggcgatctgctaccagagccgggacgtggccgaggcgatg
cggctggactcgggcgtggccctggacgtcctgcgggtcgacggcggtgtgaccgccaac
gacctgtgcatgcagacgcaggcggacatcctgggcgtccccgtcagccgcccggtggtc
gccgagacgacggcgctcggcgccgcgtacgccgccggcctcgccgtgggcttctggaag
gacaccggtgagctgtccacgcactggcgggaggagcgccgcttcgagccccgctggtcg
gcggaccggcgcgaaagcggctacgcgggctggcgcaaggccgtcgaacgcaccctgaac
tgggtggacgtggaccccggtcccgaccccggccccgaccccgggtga

DBGET integrated database retrieval system