KEGG   Frankia symbiont: FsymDg_1490Help
Entry
FsymDg_1490       CDS       T01530                                 

Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
fsy  Frankia symbiont
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fsy00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    FsymDg_1490
Enzymes [BR:fsy01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     FsymDg_1490
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1746268..1748778
Genome map
AA seq 836 aa AA seqDB search
MASDDSDSSTGSSTDSSGGSDTGTGPDAGIGNGTDRGTGAGSGSGPGAGSGAGSGPAGQA
AGNGRAVRAGGIDPPLAELADVYGVATRYVDADDREVAVDPQVVRAVLGLLDVDTADPAA
ALATARDAPWRRPLPACVIVRRSAPTPVIARVPAGTVPVAELELEDGGRRDLTGWGATVG
RRRVDGRELLGVPLALPAGLPLGDHVLRLRAGAVTATAQLVVVPDAVPGPAGAVPGRAWG
WMIQLYALRSAGSWGMGDYADLADLAAWSGGEEGGRADVLLVNPLHAAAPTFPVEPSPYF
PASRRFASPLYLHPQDLPEYARADAATRTRVDQLAATARAAAAADPPPADEPRDGEPADT
GLVAVEPADSSPEHGGLAGDDPGEAGPAAGRAGLLDRDAVWRAKLAALELLFSVSGPGEV
AGPGEADGPETGHDGLTDFATWCALAERHGPDWRRWPAHLRDPHSPAVAAARVELRERIA
FHRWLQHACDAELAAAQAAARDAGMTVGIVHDLAVGVDPGGADAWALRDVFAAGATVGAP
PDGFNQQGQDWALPPWRPDRLAETGYAPFRQMVAAVLRRGGGIRVDHVLGLFRLWWIPTG
NSAAAGTYVRYDADAMLGLLALEAARARALVVGEDLGTVESSVAARLARAGVLGSTVAWF
ERDADGEPLPPRRWREPAMASITTHDLPTVAGYLTGAHVRVRARRGLLRHSPDAELRAWR
RERDALIALLRAEGLLAVAPTAVDDLDQSALREVAFALHGLLVRSPARIVLAAPGDALGD
LRQPNLPGTVDAYPNWRLPVTDADGRSVTVERLRADPRVHRLAGLLAQVREQARRA
NT seq 2511 nt NT seq  +upstreamnt  +downstreamnt
gtggcctctgacgacagcgacagcagcaccggcagcagcactgacagtagcggcggctca
gataccggcaccggtcccgatgccggtatcgggaacggcaccgacagggggaccggcgca
ggaagcggcagcggtccgggcgccggcagcggtgccggcagcggccccgctggccaggcc
gcggggaatggccgcgccgtccgggccggcggcatcgacccgccgctggcggagctggcg
gacgtgtacggcgtcgccacccgttacgtcgacgccgacgaccgggaggtcgccgtcgac
ccgcaggtcgtgcgggcggtgctcggcctgctcgacgtcgacacggcggacccggccgcg
gcccttgccacggctcgtgacgcgccgtggcggcgtccgctgcccgcctgtgtgatcgta
cggcggtccgcgcccacgccggtgatcgcgcgggtgcccgccggcacggtccccgtcgcc
gagctggagctcgaggacggtgggcgccgcgacctcaccggatggggcgcgaccgtcggg
cggcggcgggtcgacggccgggaactcctcggcgtcccgttggccctgcccgcgggcctg
ccactgggcgatcatgtgctgcggctgcgggccggtgccgtcacagccacggcacagctc
gtcgtcgtgccggacgcggtgcccggcccggccggggccgttcccggccgggcctgggga
tggatgatccagctgtacgcgctgcggtcggccggctcgtgggggatgggcgactacgcc
gacctcgccgacctcgcggcctggtccggcggcgaggagggcgggcgcgccgacgtgctg
ctggtcaatccgctgcacgcggccgccccgacgtttcccgtcgaaccgtccccgtacttt
ccggcgagccgacgcttcgcctccccgctgtacctgcatccgcaggacctgcccgaatac
gcccgggcggacgccgccacccggacccgggtcgaccagctcgccgccaccgcccgcgcc
gcggccgccgccgacccaccgccggcggacgagccgcgggacggcgagcccgcggatacc
gggctggtggccgtcgaacccgcggacagcagcccggaacatggtgggctggcgggggac
gacccgggggaggccgggccggccgcgggccgtgccgggcttctggaccgggacgcggtg
tggcgggccaagctcgccgccctggagctgctgttcagtgtctccgggcccggagaggtc
gctggacccggcgaggcggacggaccggagacagggcacgacggcctcaccgacttcgcg
acctggtgcgctcttgccgaacggcacggcccggactggcggcgctggccggcgcacctg
cgcgacccgcacagccccgccgtcgccgccgcccgcgtcgagctgcgggaacggatcgcc
ttccaccgctggctgcagcatgcctgcgacgccgagctcgccgccgcgcaggcagccgcc
cgcgacgccgggatgaccgtcggtatcgtgcacgacctcgcggtcggcgtggatccgggt
ggcgcggacgcctgggcgctgcgggacgtcttcgccgccggtgcgaccgtgggcgcgccc
ccggacgggttcaaccagcagggccaggactgggcgctgccgccatggcggcccgaccgg
ctggcggagaccggctacgcgccgttccggcagatggtcgccgccgtgctccgccggggt
ggcggcatccgggtcgaccacgtcctcggcctgttccggctgtggtggatcccgaccggg
aactccgcggcggcgggtacctacgtccgctatgacgccgacgccatgctcggcctgctc
gcgctcgaggcggcccgggccagggcgctcgtcgtcggtgaggatctcggcacggtcgag
tcctcggtcgcggcgcggctggcccgcgccggggtgctcggctcgaccgtcgcctggttc
gaacgcgacgccgacggtgagccgctgccgccgcgacgctggcgggaaccggcgatggcg
agcatcaccacccacgacctgcccaccgtcgccggctacctcaccggcgcgcacgtgcgg
gtccgggcccgccgtggcctgctgcgacactcaccagatgccgagctgcgggcatggcgg
cgggaacgggacgcgctgatcgcgctgctgcgggccgagggcctgctggccgtggctccc
accgccgtggacgatctcgaccagtcggcgctgcgcgaggttgctttcgccctgcacggc
ctgcttgtccgctcgccggcacggatcgtgctcgcggcgccgggcgacgccctgggtgac
ctgcgtcaaccgaacctgcccggcaccgtggacgcgtacccgaactggcggctgccggtg
accgacgccgacggccggtccgtcaccgtggagcggctgcgggccgacccgcgggtacac
cgcctggccgggctgctcgcccaggtgcgcgaacaggcccggcgggcgtga

DBGET integrated database retrieval system