KEGG   Frankia symbiont: FsymDg_1697Help
Entry
FsymDg_1697       CDS       T01530                                 

Definition
glyceraldehyde-3-phosphate dehydrogenase, type I (EC:1.2.1.12)
Orthology
K00134  
glyceraldehyde 3-phosphate dehydrogenase [EC:1.2.1.12]
Organism
fsy  Frankia symbiont
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Class
Metabolism; Overview; Carbon metabolism [PATH:fsy01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:fsy01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:fsy00010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2001088..2002095
Genome map
AA seq 335 aa AA seqDB search
MVTRVGVNGFGRIGRNFWRALQASKRNDIEIVAVNDLTDNRTLAHLLKYDTTLGTLSESV
SPADGGIKVGDGFLKVVSERDPAALPWGDLGVEVVVESTGRFTKAEDARKHLEAGAKKVI
ISAPAKGEDLTVVIGVNDDVYDPAKHTILSNASCTTNCVAPLAKVLEDAFGIERGLMTTV
HAYTNDQVILDFPHSDLRRARAAAQNIIPTTTGAAKATSLVLPQLKGKLDGLAMRVPVLD
GSVTDLVATLKREVTIEEVNAAYRAAAEGALKGILVYTEDPIVSSDIVGTAASCTFDSLL
TMASGNQVKVIGWYDNEWGYSNRLVDLTALVGGRL
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
gtggttacgcgagtgggtgtcaacggcttcggccgtatcggccgcaacttctggcgggcg
cttcaggctagtaagcgtaacgacatagagatcgttgcagtgaacgaccttaccgacaac
aggacacttgcgcatctgctcaagtacgatactacgctgggcacactgtcggagtcggtg
agtcccgccgacggcgggatcaaggtcggcgacggcttcctcaaggtggtctccgagcgt
gacccggcggccctgccctggggggacctcggggtcgaggtcgtcgtcgagtccaccggc
cggttcaccaaggccgaggacgcgcgcaagcacctcgaggcgggcgcgaaaaaggtgatc
atctccgcgccggccaagggtgaggacctcaccgtcgtcatcggcgtgaacgacgacgtc
tacgacccggcgaagcacacgatcctgtcgaacgcctcctgcacgaccaactgcgtggcg
ccactggccaaggttctcgaggacgccttcggcatcgagcgcggcctgatgacgaccgtg
cacgcctacaccaacgaccaggtcatcctcgacttcccgcactcggacctgcgccgcgcc
cgcgccgccgcccagaacatcatcccgacgacgaccggtgcggccaaggcgacgtccctg
gtactgccgcagctcaagggcaaactggacggactggcgatgcgtgttcccgtcctcgac
gggtcggtgaccgacctggtcgccacgctcaagcgtgaggtcacgatcgaggaggtcaac
gctgcgtaccgggccgccgccgagggcgcgctcaagggcatcctcgtctacaccgaggat
ccgatcgtctcctccgacatcgtggggacggctgcgtcctgcacgttcgactcgctgctc
accatggccagcggcaaccaggtgaaggtcatcggctggtacgacaacgagtggggctac
tccaaccgcctggtggacctcaccgccctcgtcggcggacgcctgtag

DBGET integrated database retrieval system