KEGG   Frankia symbiont: FsymDg_1699Help
Entry
FsymDg_1699       CDS       T01530                                 

Definition
(RefSeq) triosephosphate isomerase (EC:5.3.1.1)
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
fsy  Frankia symbiont
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:fsy00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    FsymDg_1699
   01230 Biosynthesis of amino acids
    FsymDg_1699
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    FsymDg_1699
   00051 Fructose and mannose metabolism
    FsymDg_1699
   00562 Inositol phosphate metabolism
    FsymDg_1699
Enzymes [BR:fsy01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     FsymDg_1699
Exosome [BR:fsy04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   FsymDg_1699
  Exosomal proteins of bladder cancer cells
   FsymDg_1699
  Exosomal proteins of melanoma cells
   FsymDg_1699
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2003590..2004417
Genome map
AA seq 275 aa AA seqDB search
MAGDKNEKNKNEKKPRGTGRRTLVAGNWKMNLNHLEAIALVQKIAFDLKPVELDNAEVVV
LPPFTDLRSVQTLVDGDRLAIGYGAQDLSPHSSGAHTGDISGPLLARLGCSYVVVGHSER
RANHHEDDALVAAKARAAYAHGITPILCVGEPEPVRVAGDHATYVLAQLDGSLDGITLEQ
ARTLVVAYEPVWAIGTGRTASAHDAQEMCAAIRGRLAARFDAGVAAVIRILYGGSVKGSN
AAELFTQPDVDGGLVGGASLDAVDFAAIVRSAPPS
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atggccggtgacaagaacgagaagaacaagaacgagaagaagccccgggggacgggtcgg
cgcaccctggtcgcgggcaactggaagatgaacctcaaccatcttgaggcgatcgcgctg
gttcagaagatcgctttcgacctcaagccggtcgagctcgacaatgccgaggtcgtcgtc
ctgcccccgttcaccgacctgcgcagcgtccagaccctcgtcgacggggacaggctcgcg
atcggctatggcgcgcaggacctctccccgcacagctccggcgcccacaccggggacatc
agcgggcccctgctcgcccggctgggatgcagctatgtggtggtcggccactccgagcgg
cgcgcgaaccatcacgaggacgacgccctggtggcggccaaggcgcgggccgcctacgcg
cacgggatcaccccgatcctgtgcgtgggcgagcccgagccggtgcgggtggccggtgac
catgccacctatgtcctcgcgcagctcgacggctccctggacgggatcaccctggagcag
gcacgcacgctggtcgtcgcctacgagccggtgtgggcgatcggcaccgggcggaccgcc
tccgcccacgacgcgcaggagatgtgcgcggcgatccgggggcggctcgccgcgcgtttc
gacgcgggagtcgccgcggtcatccgtattctctacggtggttcggtgaagggctccaac
gcggcggagctgttcacccaacccgacgtggacggcggactcgtcggcggcgcgagcctg
gacgcggtggacttcgcggcgatcgtccgcagcgccccgccgagctga

DBGET integrated database retrieval system