KEGG   Frankia symbiont: FsymDg_2008Help
Entry
FsymDg_2008       CDS       T01530                                 

Definition
acetate--CoA ligase (EC:6.2.1.1)
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
fsy  Frankia symbiont
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:fsy00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    FsymDg_2008
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    FsymDg_2008
   00620 Pyruvate metabolism
    FsymDg_2008
   00640 Propanoate metabolism
    FsymDg_2008
  Energy metabolism
   00680 Methane metabolism
    FsymDg_2008
Enzymes [BR:fsy01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     FsymDg_2008
Lipid biosynthesis proteins [BR:fsy01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   FsymDg_2008
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2389801..2391804
Genome map
AA seq 667 aa AA seqDB search
MTEHTGTEHTGTEHAGTGYTWTPTSEYIENANVTRLARAHGLSSLAELRERSVRDIGWYW
DAVVKDLGLPFRTPYSRVVDLSAGIEHPDWFVGGELNIVDACLGRWDGDASVANRPAVIH
TAEDGTTTTVTYRELTRQVERVSAGLRRLGIGRGDAVALFLPMIPEAVVASYAVARIGAV
LVPLFSGFAPSAIASRIQDADARAVVVADGTIRRRRAVAMKPLLDEALRSCPTVEHVVVV
GNLDDAPETSATRDVRWSDLLTGPDDAGPDGAGEAEALRATDTLLLAYTSGTTGRPKGAV
HTHAGFLVKVASEVAYSFDVGPGGVFCWVTDMGWIMGPLSIFGTHANGATLLLYEGSPDV
PDTNRLWDLVDRHRVTMLGVSPTLIRTLRSSEKISLDDFDLSSVRVLGSTGEPWHPDSYE
WLARDVFGGRVPIINFSGGTEVGGSFLAPYPVEPIRSCSLGGPSLGMDVDVVDDRAQPVR
GEVGELVCRQPWPAMTRGVWRDEARYLEAYWSTFPGLWRHGDFALVDKDGQWFILGRSDD
VMNVAGKRLAPAEVESVMITHPAVAEAAAVGVPDPKKGEAVWAFWVPRPDATEDVSAQLR
EMVAAELGKPFAPGLVRRVSQLPKTRSAKILRRAVRAAALGRDPGDLSGAENPDAVEEIR
AAVGLDA
NT seq 2004 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgagcatactgggaccgagcacaccgggaccgaacacgccgggaccgggtacacc
tggacccccacctcggagtacatcgagaacgccaacgtcacccggttggcgcgggcgcac
ggcctgtcgtcgctggccgagttgcgcgagcgctcggtgcgcgacatcggctggtactgg
gacgccgtggtcaaggacctgggcctgcccttccgcacgccgtactcgcgggtggtcgac
ctctccgcgggtatcgagcatcccgactggttcgtgggcggcgagctcaacatcgtcgac
gcctgcctggggcgctgggacggtgacgcctcggtcgcgaaccggccggccgtcatccac
acggccgaggacggcacgaccacgacggtgacctaccgtgagctcacccggcaggtggag
cgggtcagcgccggcctgcgccggctcgggatcggcaggggcgacgcggtcgccctgttc
ctgccgatgatccccgaggccgtcgtcgcctcctacgcggtcgcccgcatcggcgcggtc
ctggtgccgctgttctccgggttcgcgccctccgccatcgcctcccgtatccaggacgcc
gacgccagggcggtcgtcgtcgccgacggcaccatccggcgccgccgcgcggtggccatg
aaaccgctgctcgatgaggcgttgcggtcctgcccgacggtggagcacgtcgtcgtcgtc
ggcaacctcgacgatgccccggagacctccgcgaccagggatgtccggtggagcgacctg
ctcaccggcccggatgacgccggcccggacggcgctggcgaggccgaggcgctgcgcgcg
accgacaccctgctgctggcgtacacctccgggacgacgggccggcccaagggtgccgtc
cacacccacgcaggcttcctggtgaaggtggccagcgaggtcgcctactccttcgacgtc
ggcccggggggcgtgttctgctgggtgacggacatgggctggatcatgggcccattatcg
atcttcgggacgcacgccaacggcgcgacgctgctgctctacgagggctcgcccgacgtg
cccgacaccaaccgcctgtgggacctggtggaccggcaccgcgtcaccatgctcggggtc
tcgccgacgctgatccgcacgctgcgctccagcgagaagatctcgctggacgacttcgat
ctgtcgtcggtgcgcgtgctcggctcgacgggtgagccatggcaccccgactcctacgaa
tggctggccagggacgtcttcggggggcgggtcccgatcatcaatttctcgggcggcacc
gaggtcggcggatccttcctcgcgccgtacccggtcgagcccatccgcagctgctcgctg
ggcggcccgtcgctgggcatggacgtcgacgtggtggacgaccgggcacagccggtgcgc
ggtgaggtcggcgagctggtgtgccgtcagccctggccggcgatgacgcgcggggtgtgg
cgggacgaggcccgctatctcgaggcgtactggtcgaccttccccggcctgtggcgccac
ggcgacttcgccctggtcgacaaggacgggcagtggttcatcctgggccgctccgacgac
gtcatgaacgtggcgggcaagcgcctggcaccggccgaggtcgaatctgtcatgatcacc
catccggcggtggccgaggcggcggcggtcggcgtcccggacccgaagaagggcgaggct
gtctgggcgttctgggttccccgcccggacgcgacggaggacgtctcggcgcagttgcgg
gagatggtcgcggccgagctcggcaagcccttcgccccggggctggtccggcgtgtgtcg
caactgcccaagacgcggtcggcgaagatactgcggcgcgcggtgcgggcggcggccctg
ggccgggatcccggggatctttccggcgcggagaacccggacgcggtggaggagatccgc
gcggcggtcgggctggacgcctga

DBGET integrated database retrieval system