KEGG   Frankia symbiont: FsymDg_2076Help
Entry
FsymDg_2076       CDS       T01530                                 

Definition
3-hydroxybutyryl-CoA epimerase (EC:5.1.2.3)
Orthology
K01782  
3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
fsy  Frankia symbiont
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Biosynthesis of unsaturated fatty acids
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:fsy00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    FsymDg_2076
   01212 Fatty acid metabolism
    FsymDg_2076
  Carbohydrate metabolism
   00640 Propanoate metabolism
    FsymDg_2076
   00650 Butanoate metabolism
    FsymDg_2076
  Lipid metabolism
   00071 Fatty acid degradation
    FsymDg_2076
   01040 Biosynthesis of unsaturated fatty acids
    FsymDg_2076
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    FsymDg_2076
   00310 Lysine degradation
    FsymDg_2076
   00380 Tryptophan metabolism
    FsymDg_2076
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    FsymDg_2076
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    FsymDg_2076
   00281 Geraniol degradation
    FsymDg_2076
  Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    FsymDg_2076
Enzymes [BR:fsy01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     FsymDg_2076
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     FsymDg_2076
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     FsymDg_2076
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2468917..2471085
Genome map
AA seq 722 aa AA seqDB search
MAYTETIQWAHDPDGVVVLTLDDPQASANTLNRDFVESLQAAVDRLEREKETITGVVLTS
AKKTFFAGGNLNELRALRKEDAAEFTAHLNRIKGLLRALETYDRPVVAAFNGAALGGGLE
LGLATHHRIAADVPGNQIGLPEVGLGLLPGCGGVVRTVRILGVVDALNKVLLPGTRFSPA
DAVEVGLVDEIVATIPELVPRAKEWIQKNPEARQPWDVKGFQIPGGAPDSPSLAPVLPSL
TAKLRAQLGGSPLQAPRAIVAAAVEGAQVDADTASLIETRYLIHLATGQVAKNLIQAFFF
DTQHIKAGGSRPAGFDRFQARKVGVLGAGMMGAGIAYAAAKVGIEVVLKDVSLAAAERGK
AGVEKTLSRAVAKGKTPQAEADAILGRILPTEDPADFAGVDFVVEAVFESVELKHKVFGE
IEEIVDPDAVLGSNTSTLPITLLAQGVQRPEDFIGIHFFSPVDRMALVEIIKGERTSERT
LARVFDFVQQIRKTPIVVNDSRGFFTSRVIIAFLNEAVAAVGDGIAPASIEQAALQAGYP
AGALQLIDELTLTLPRKIRQEARAAVEAAGGVWKEHAAEAVIDRLIDEFGRPGRSGGAGF
YEYDDSGGRQGLWPGLHEAFRVPGRTIPFEDLKERLLFAETLEAVRARDEGVITSIPDAN
IGSLFGIGFPSWTGGVFQYIDQYKGGTAGFVARANELAERYGERFTPPDSLVRAAAAGAS
YA
NT seq 2169 nt NT seq  +upstreamnt  +downstreamnt
atggcgtacacagaaaccatccaatgggcgcacgaccccgacggcgttgtcgtgttgacc
ctggatgacccgcaggcttcggcgaacaccctcaaccgggacttcgtcgagtcgttgcag
gcagccgtcgacaggctcgagcgggagaaggagacgatcaccggggtcgttctcacgtcc
gcgaagaagaccttcttcgccggcggcaacctcaacgagctcagggcgctgcgcaaggag
gacgccgcggagttcaccgcgcacctcaaccggatcaaggggctgctgcgcgccctggag
acctacgaccggccggtcgtggccgccttcaacggcgccgccctcggcggcggtctcgag
ctcgggctggccacccaccaccggatcgccgccgacgtcccgggcaaccagatcggtctg
ccggaggtcgggctcgggctgctgcccggctgcggcggggtggtgcggaccgtgcgcatc
ctcggcgtcgtcgacgccctgaacaaggtgctgctgcccggcacccggttcagcccggcc
gacgcggtcgaggtcgggctggtcgacgagatcgtggcgaccatccccgagctggtcccc
cgggccaaggagtggatccagaagaaccccgaggcgcgccagccgtgggacgtcaagggc
ttccagatacccggcggggcaccggactccccgtcgctggcgccggtcctgcccagcctg
acagccaagctgcgtgcccagctcggcggctcgccacttcaggcgccgcgggccatcgtc
gccgccgccgtggagggcgcgcaggtcgacgccgacacggcgtcgctgatcgagacccgg
tacctgatccacctggccaccggccaggtggccaagaacctgatccaggcgttcttcttc
gacacccagcacatcaaggccggtggtagccggccggccgggttcgaccgcttccaggcg
cgcaaggtcggtgttctcggggccgggatgatgggcgcgggtatcgcctacgcggcggcg
aaggtcgggatcgaggtggtcctgaaggacgtcagcctcgccgccgccgagcgtggcaag
gccggtgtcgagaagaccctctccagggcggtggccaaggggaagacgccgcaggcagag
gcggacgcgatactcggccgaatcctgccgacggaggatccggccgacttcgccggggtc
gacttcgtcgtcgaggcggtcttcgagagcgtcgagctcaagcacaaggtcttcggcgag
atcgaggagatcgtcgatccggacgcggtgctcgggtcgaacacctcgaccctgccgatc
accctgctggcgcagggggtccagcggccggaggacttcatcggcatccacttcttctca
ccggtcgaccggatggccctggtcgagatcatcaagggtgagcgcacctcggagcgcacc
ctggccagggtcttcgacttcgtgcagcagatccgcaagacgcccatcgtcgtcaacgac
agccgcgggttcttcaccagtcgggtcatcatcgccttcctcaacgaggcggtcgcggcc
gtcggtgacggcatcgctcccgccagcatcgagcaggccgcgttgcaggccggctatccc
gccggcgcgctgcagctcatcgacgagctcacgctgaccctgccgaggaagatccgccag
gaggccagggccgcggtcgaggccgccggcggggtctggaaggagcacgcggcggaggcg
gtcatcgaccggctgatcgacgagttcgggcggccgggccgttccggcggcgccggtttc
tacgaatacgacgactccggcggccggcagggactgtggccgggccttcatgaggcgttc
cgggtaccgggccgcacgatcccgttcgaggatctcaaggagcggctgctgttcgccgag
acgctggaggccgtccgcgcgcgggacgagggggtcatcacctcgatacccgatgccaac
atcggctcgttgttcggcatcggtttcccctcgtggaccggtggagtgttccagtacatc
gaccagtacaagggcggaacagccggattcgtggcgcgggcgaacgagctggccgagcgt
tacggcgaacggttcaccccgccggactccctggtgcgggcggcggccgcgggcgcgtcg
tacgcatag

DBGET integrated database retrieval system