KEGG   Frankia symbiont: FsymDg_2116Help
Entry
FsymDg_2116       CDS       T01530                                 

Definition
(GenBank) 3-hydroxyisobutyryl-CoA hydrolase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
fsy  Frankia symbiont
Pathway
fsy00071  Fatty acid degradation
fsy00280  Valine, leucine and isoleucine degradation
fsy00281  Geraniol degradation
fsy00310  Lysine degradation
fsy00360  Phenylalanine metabolism
fsy00362  Benzoate degradation
fsy00380  Tryptophan metabolism
fsy00410  beta-Alanine metabolism
fsy00627  Aminobenzoate degradation
fsy00640  Propanoate metabolism
fsy00650  Butanoate metabolism
fsy00903  Limonene and pinene degradation
fsy00930  Caprolactam degradation
fsy01100  Metabolic pathways
fsy01110  Biosynthesis of secondary metabolites
fsy01120  Microbial metabolism in diverse environments
fsy01130  Biosynthesis of antibiotics
fsy01212  Fatty acid metabolism
Module
fsy_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:fsy00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    FsymDg_2116
   00650 Butanoate metabolism
    FsymDg_2116
  Lipid metabolism
   00071 Fatty acid degradation
    FsymDg_2116
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    FsymDg_2116
   00310 Lysine degradation
    FsymDg_2116
   00360 Phenylalanine metabolism
    FsymDg_2116
   00380 Tryptophan metabolism
    FsymDg_2116
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    FsymDg_2116
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    FsymDg_2116
   00281 Geraniol degradation
    FsymDg_2116
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    FsymDg_2116
   00627 Aminobenzoate degradation
    FsymDg_2116
   00930 Caprolactam degradation
    FsymDg_2116
Enzymes [BR:fsy01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     FsymDg_2116
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_2 ECH_1
Motif
Other DBs
NCBI-ProteinID: AEH09529
JGI: FsymDg_2116
UniProt: F8AY96
Position
complement(2517437..2518516)
Genome map
AA seq 359 aa AA seqDB search
MTDVLFTVRGRLGRITLNRPRAINALNHGMLRRIADALTAWEHDERIRAVLIDGAGERGL
CAGGDIRSIYDDVSSGGTTALDFWVDEYRLNARISHYPKPYVALMDGLVMGGGVGVSSHG
SVRVVTERSLVAMPEVAIGLVPDVGGTYLLSRMPGRSGTHVALTTARISGADAIHHGLAD
HYVPSDRLGALAAALGSGDDRDPVDVVRSFAEPPPASALAAQASWIDHCYAARTVEEILD
RLNDHGGPAAAAAKEIAKRSPTALKVTLRALRSAAELPSLEAVLDQEYRVSSACLHSHDL
AEGIRAQVVDKDRNPRWSPATLAEVGDDLVASFFAPLGAGELGLAAAPAHGVTADGVTA
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacgtgctgttcaccgtccggggccggctgggccggatcaccctcaaccggccg
agggccatcaacgcgctcaaccacggcatgctgcgccgcatcgccgacgctctgaccgcc
tgggagcacgacgagcgtatccgggcggtgctgatcgacggtgccggcgagcgggggctg
tgcgccggcggtgacatccggtccatctatgacgacgtcagctccggcggcaccaccgcc
ctggacttctgggtcgacgagtatcggctcaacgcccgcatcagccactacccgaaaccg
tatgtcgcgctgatggacgggctggtcatgggcgggggtgtgggcgtctcctcgcatggc
agcgtgcgggtggtcaccgaacgctcccttgtcgccatgcccgaggtcgcgatcggtctc
gtgcccgacgtcggcggcacctatctgctgtcccggatgccaggccggtcgggcacccac
gtcgcgctcaccaccgcgcggatatccggcgccgacgccatccaccacgggctggccgat
cactacgtgcccagcgaccggctcggcgcgctggccgccgcgctgggcagcggtgacgac
agggatccggtcgatgtggtccgctccttcgccgagccgccaccggccagtgcgctggcc
gcgcaggcgagctggatcgaccactgctacgcggcgcggaccgtcgaggagatcctggac
cggttgaacgaccacggcgggccggccgcggccgcggcgaaggagatcgcaaaaagatca
cccaccgcgctcaaggtcaccctgcgtgcgctccggtcggcggccgagctgcccagcctg
gaggcggtgctcgaccaggagtaccgggtctccagcgcctgcctgcactcgcacgacctc
gccgagggcatccgggcccaggtcgtcgacaaggaccgcaacccccgctggtcgccggca
accctggccgaggtcggtgacgacctcgtcgccagcttcttcgcgcccctgggcgccggc
gagctcggactcgccgccgctcccgcccacggcgtgacggctgacggcgtgacggcgtag

DBGET integrated database retrieval system