KEGG   Frankia symbiont: FsymDg_2268Help
Entry
FsymDg_2268       CDS       T01530                                 

Definition
exodeoxyribonuclease V (EC:3.1.11.5)
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
fsy  Frankia symbiont
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:fsy00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    FsymDg_2268
Enzymes [BR:fsy01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     FsymDg_2268
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2708795..2711029)
Genome map
AA seq 744 aa AA seqDB search
MPAETISTDALPSLASAGVPADGPANGTAVDPAVLFTAFCAAGLWPGLGRTTAARLPDAG
IRAPSDVDATRLATVPGVPPARARRLVESFSAAGGAYAAAELLILADLPVRLVRRLVDEL
GPGVADALRADPWALLAAGEAELTQADRLARAMGARRDDDRRGPAVVTYLLRRAASRVGD
TAAEVGPLLQAAARDGVGDPVAALGSAVEDGQVVITGELAALERYATAEQALAEGVARLL
ALAEPLRPGSVRPRPTTATPTGATPARRPAAADDDLPGMFDALDDIDALDLEEGKDGEEP
GGPTDAAAGEAAPAADADGPEGADENDEDDENLAAVLAGLDETQLRAARTALDAGVSLLT
GGPGTGKSRTVAAVVRLARAAGAQVALAAPTGRAAKRLEELCEWPASTLHRLLQAQGTSG
TFARDADNPVEADLVVVDEVSMLDAELAAALVDACADGTHLLLVGDPAQLPSIGPGRVLA
DLLAAGVVPVTELQRLYRQSEGGGIATLATAVRAGELPPPPSGPDREVVVVPTRGAGEAA
HRVVQLVTDSIPRALGIPVADIQVVTPVHGGPAGTQALNAALKQALNPGTRAGGGFDVGD
RVVATANHLDDGFANGEIGVVTAVGDKGALTVAFPGGAVEVPGGIVGDLRHGWAVTVHRA
QGSEWPAVVAVFPPEAGRMLTRPLIYTALTRARRHLSVVSVNGPALRAAVHRSGGRQRAT
LLPALLAQEVQPEAADEEGRQAEA
NT seq 2235 nt NT seq  +upstreamnt  +downstreamnt
atgccggccgagaccatctccaccgacgcgctacccagcctggccagcgccggggtgcca
gcggacggcccggcgaacggcacggccgtcgacccggcagtgctgttcacggccttctgc
gccgccgggctgtggccgggtctcggccggacgaccgcggcccgcctgcccgacgccggg
atccgcgccccgtccgacgtggacgcgacccggctggcgaccgtccccggtgtccctccc
gcacgggcccggcggctggtggagtccttctccgccgccgggggcgcctatgccgcggcc
gagttgctgatcctggccgatctgccggtccgcctggtccgccggctggtcgacgaactc
gggccgggggtggccgacgccctgcgcgccgatccgtgggcgttgctcgccgcgggcgag
gcggagctcacccaggccgaccggttggcccgggccatgggtgcgcgccgcgacgacgac
cgccgtggccccgcggtggtcacgtacctgctgcgccgggccgcgtcccgcgtcggggac
acggcggcggaggtgggcccactgctgcaggccgccgcccgcgacggggtcggggacccg
gtggcggcgctgggcagcgccgtcgaggacggtcaggtggtcatcaccggtgagctggcc
gcgctcgagcggtacgccacggccgagcaggccctggccgagggggtcgcgcggctgctg
gccctcgccgagccgctgcgccccggatccgtccgcccccggccgaccacggcgacccca
acgggcgcgacaccggcacgtcgaccggccgccgccgacgatgatcttcctggcatgttc
gacgccctggacgacatcgacgctctcgatcttgaggagggcaaggacggcgaggagcca
ggcggccccacggacgccgctgccggggaagcggccccggcagcggacgcggacgggccc
gagggggcggacgagaacgacgaggacgacgagaaccttgccgcggtcctggccggcctg
gacgagacccagctgcgcgccgcccgcaccgccctcgacgccggcgtgagcctgctcacc
ggcgggccggggacgggcaagagccggacggtcgccgcggtcgtgcggctcgcccgcgcc
gccggcgcgcaggtggccctggcggcgccgaccggccgggccgccaaacggctggaggag
ctgtgcgagtggccggcgagcacgctgcaccggctgctgcaggcgcagggcacctccggg
accttcgcgcgcgacgccgacaacccggtcgaggcggacctggtcgtggtcgacgaggtg
tccatgctcgacgccgagctcgccgcggccctcgtcgacgcctgcgcggacggcacccat
ctgctgctcgtcggggaccccgcgcagctgcccagcatcggcccgggccgggtgctggcg
gacctgctggcggccggggtggtgcccgtgaccgagctgcagcgcctctaccggcagtcc
gagggcggggggatcgcgacgctggcgacggccgtgcgcgccggtgagctgcccccaccc
ccgtccgggccggaccgcgaggtggtggtggtgcccacccgcggcgcgggcgaggcggca
caccgggtcgtccaactggtcaccgactccatcccacgggcgctgggcatcccggtcgcg
gacatccaggtggtgacccccgtccacggcggccccgcggggacgcaggcgctcaacgcc
gcgctcaagcaggcgctcaaccccggtacccgggcgggcggcgggttcgacgtcggggac
cgggtggtggccaccgcgaaccatctcgacgacgggttcgccaacggcgagatcggcgtg
gtgaccgcggtcggtgacaagggcgcgctcacggtggcgtttcccggcggggcggtggag
gtcccgggcgggatcgtcggggacctgcggcacggctgggcggtcacggtccaccgggcc
cagggcagcgagtggccggcggtggtggccgtgttcccgccggaggcgggccggatgctg
acccgtccgctgatctacaccgcgttgacccgggcgcggcggcatctgtcggtggtgtcc
gtcaacggcccggcgctgcgggccgcggtgcaccgctccggcggtcggcagcgcgccacc
ctgctgccggccctgctcgcccaggaggtccagcctgaggcggccgacgaggagggacgg
caggccgaagcatga

  All links  
No link information was found.   
DBGET integrated database retrieval system