KEGG   Frankia symbiont: FsymDg_2349Help
Entry
FsymDg_2349       CDS       T01530                                 

Definition
(GenBank) Magnesium chelatase
  KO
K03404  magnesium chelatase subunit D [EC:6.6.1.1]
Organism
fsy  Frankia symbiont
Pathway
fsy00860  Porphyrin and chlorophyll metabolism
fsy01100  Metabolic pathways
fsy01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:fsy00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    FsymDg_2349
Enzymes [BR:fsy01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     FsymDg_2349
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: VWA_2 VWA Mg_chelatase AAA_5 MCM Sigma54_activat AAA_16
Motif
Other DBs
NCBI-ProteinID: AEH09735
JGI: FsymDg_2349
UniProt: F8B0I6
Position
2792947..2795181
Genome map
AA seq 744 aa AA seqDB search
MTAYPLSAVVGMDDLRLALVLNAVSPAIGGVLVRGEKGTAKSTAVRGLAALLPPLRVVTN
CRFACDPAVGDADCPDGPHPPDGPAVTRAVRMVELPVGASEDRVTGSIDLDRALAEGVTA
LRPGLLAAAHRGLLYVDEVNLLHDHLVDLLLDAAALGVAHVERDGVSVRHAARFLLVGTM
NPEEGELRPQLLDRFGLTVEVAASRDPRVRAEVVRRRLAYDADPRAFTAAWARQDAALAA
RIAAARDRLPAVELSETALRQVTAVCAAFDVDGMRADVVTARTAIALAAWEGRERVTADD
IRRAARLALPHRRRRGPFDAPGLDEDTLADALEKAGEPSTDPDGPPPAGGGGSGSAAGHG
DAAADSRDGHAGDGPPPTSAGDLPTPRPAESEPLHRAETQRTETGAAAEPRPACGPTTAS
EHSGYEQPDPSRGQTDTADVRPAGPPGPTFRPRRLEIPDVGTGLGTAGRRSRARTRHGAV
VTDSPEAAGLHLPATLRAAAPWQRARGRRGPGLLLRPSDRRGAVREGREGNLVLFVVDAS
GSMAARARMRTVTTAVLSLLLDAYQRRDRIGMITFRGASAEVVLPPTSSVEVGAARLRSL
PTGGRTPLAAGLTRAGQVLAAERRRDPDRRALLVVVTDGRCTTGPDPAAAAHALARAGVA
SVVVDCESGYVRLGLAGRLATALGGTTVPLAALSAAGPAVATGPTVPAGPVRPIRPAGSG
SARFGGPAEPTVGPTAPTQPGKVA
NT seq 2235 nt NT seq  +upstreamnt  +downstreamnt
atgacggcctacccgctgtccgcggtggtgggtatggacgacctgcggctcgccctcgtc
ctcaacgctgtgtcaccggccatcggcggggtgctcgtccggggggagaagggcaccgcc
aagtcgacggcggtgcgggggctcgccgccctgctcccgcccctgcgggtggtgaccaac
tgccggttcgcctgcgacccggcagttggcgacgccgactgccccgacggcccgcatccg
cccgacggccccgccgtgacccgggcggtgcggatggtggagctgccggtcggcgcctcc
gaggacagggtgaccgggtcgatcgacctcgaccgggcgctcgccgaaggcgtcacggcg
ctgcgccccgggctgctggccgccgcccaccgcggcctgctctacgtcgacgaggtcaac
ctcctgcacgatcaccttgtcgacctgctgctggacgcggccgcgctcggtgtcgcccac
gtcgagcgcgacggggtgtcggtccgccacgccgcccggttcctgctggtcgggacgatg
aacccggaggagggcgagctgcgcccgcagctgctggaccggttcgggctgaccgtcgag
gtcgccgccagccgggacccgcgggtacgcgccgaggtggtgcgccgccgactggcctac
gacgccgacccgcgggccttcaccgccgcctgggcgcggcaggacgccgccctcgccgcc
cggatcgccgccgcccgtgaccgcctgcccgccgtggagctctccgagacggcgttgcgc
caggtcaccgcggtctgcgccgccttcgacgtggacgggatgcgcgcggacgtggtcacc
gcccgcaccgcgatcgcgctggccgcctgggagggccgcgagcgcgtcaccgccgacgac
atccgccgcgccgcccgcctggcactgccgcaccggcgccgccgaggcccgttcgacgcc
cccggcctggacgaggacaccctcgccgacgccctggaaaaagcgggggagccgtctacg
gacccggacggaccgccgccggccggcggcggtggcagcggatccgccgccggccacggc
gacgccgctgccgacagccgtgacggacatgccggcgacgggccaccgcccacgtcggcc
ggcgacctgccgaccccgcgcccggcggaatcggaacccctgcaccgggcggaaacgcaa
cgaacggaaacaggcgcggcggcggaaccgcggcccgcctgcgggccgaccaccgcgtcc
gaacacagcgggtacgagcagcctgacccgtcgcgcgggcagaccgacaccgccgacgtc
cgtcccgccggcccacccggcccgaccttccgcccccgccgcctggagatccccgacgtc
ggtaccggccttggcaccgccgggcggcgctcccgggcccgcacccgtcacggcgcggtg
gtcaccgactcaccggaggccgccggcctgcacctgccggcgaccctgcgggcggccgcg
ccctggcagcgggcccgcggacgccgcgggccggggctgctgctgcggccgtccgaccgg
cgcggcgctgtccgggagggacgcgagggcaacctggtgctgttcgtggtggacgccagc
ggctccatggccgcccgcgcccggatgcgcacggtcaccaccgccgtgctctccctgctc
ctggacgcctaccagcgccgtgaccggatcggaatgatcaccttccggggtgccagcgcc
gaggtcgtcctgccgccgacatcgagcgtggaggtgggtgcggcccggctgcgttccctg
ccgaccggcgggcgcaccccgctcgccgccgggctcacccgcgccgggcaggtgctggcc
gccgaacgccggcgtgaccccgaccggcgcgcgctgctggtcgtcgtcaccgacgggcgg
tgcaccaccggcccggatccggccgccgccgcgcacgcgctggcccgcgccggggtagcc
agcgtcgtcgtcgactgcgagagcggctacgtccgcctgggcctggccgggcggctggcc
accgccctcggtggcacgaccgtcccgctggccgccctgtcggcagccggcccggcggtc
gccaccggccccacggtccccgccggtcccgtgcgcccgatacggccggcgggatcgggc
tccgcccggttcggcgggcccgccgaaccgaccgttgggccgacagctcccacccagccc
gggaaggtggcctga

DBGET integrated database retrieval system