KEGG   Frankia symbiont: FsymDg_2502Help
Entry
FsymDg_2502       CDS       T01530                                 

Definition
(GenBank) Histidinol dehydrogenase
  KO
K00013  histidinol dehydrogenase [EC:1.1.1.23]
Organism
fsy  Frankia symbiont
Pathway
fsy00340  Histidine metabolism
fsy01100  Metabolic pathways
fsy01110  Biosynthesis of secondary metabolites
fsy01230  Biosynthesis of amino acids
Module
fsy_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:fsy00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    FsymDg_2502
Enzymes [BR:fsy01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     FsymDg_2502
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histidinol_dh
Motif
Other DBs
NCBI-ProteinID: AEH09870
JGI: FsymDg_2502
UniProt: F8B276
Position
complement(2968157..2969521)
Genome map
AA seq 454 aa AA seqDB search
MGAEGVGIREIDGSGVGTDTLIVVLRTLDLRGSLPSPPRVRGLLPRAALDVDAALETVRP
VCDDVRDRGDAAVLDAGERFDGVRPASVRVAADALAAALDGLDPRVRDALEEVIRRTRLV
HRAQRREPVTIDVAPGTRVTERWIPVQRVGLYVPGGRVAYPSSVVMNVVPAQEAGVGSLA
LASPPQAEFGGLPHPVVLAAAALLGVDEVYAAGGAQAIAMFAHGTSSCPAVDVVTGPGNI
YVTAAKRLLRGLVGVDAEAGPTEVAILADDTADPAHVAADLIAQAEHDPMAACLLVTPSR
DLLDAVETELDKQVAVTRHQERVRTALTGQGAAVLVDDVDEGLAVVDAWAAEHLEIQTAD
AAAVAGRVRNAGAVFVGVWAPVSLGDYLAGSNHVLPTGGTARHSGGLSVSAFQRQVHVVE
CDRDALAEVAPRIAALGGAEDLIAHVDAVEVRLR
NT seq 1365 nt NT seq  +upstreamnt  +downstreamnt
atgggggcggagggcgttgggatccgggagatcgacggatcgggggtgggtaccgatacg
ctcatcgtcgtgctgagaacgctcgacctgcgtggaagtctgccgtcaccgccacgggta
cgcgggctgctgccccgcgccgcgctggacgtcgacgcagcgctggaaacggtccgcccg
gtctgcgacgacgtgcgtgaccggggggacgccgcggtcctcgacgcgggggagcggttc
gacggggtgcggccggcctcggtccgggtcgccgcggacgcgctggccgccgcgttggac
ggcctcgacccgcgggtacgggacgcccttgaggaggtgatccggcgcaccaggctggtg
caccgcgcccagcgccgcgaaccggtgaccatcgacgtggccccgggcaccagggtgacg
gagcgttggatcccggtgcagcgggtcggcctctacgtgccgggcgggcgggtcgcctac
cccagcagcgtggtgatgaacgtcgtgccggcgcaggaggccggggtcggctccctggcg
ctggcgtcgccaccgcaggcggagttcggcggtctgccgcatccggtggtcctcgccgcc
gccgcgctgctgggcgtggacgaggtgtatgccgccggcggcgcccaggcgatcgcgatg
ttcgcccacgggacgtccagctgcccggcggtggacgtggtgaccgggccgggcaacatc
tacgtgaccgcggcgaagcggctgctgcgcggcctggtcggagtggacgccgaggccgga
ccgaccgaggtcgcgatcctcgccgacgacaccgcggaccccgcccacgtcgccgccgac
ctgatcgcccaggccgagcacgacccgatggccgcctgcctgctggtcaccccgtcgaga
gacctgctcgacgcggtcgagaccgaactcgacaagcaggtcgcggtgacccgccaccag
gaacgggtacgcacggcactgaccggccagggggcggcggtgctggtcgacgacgtcgac
gagggcctggcggtggtcgacgcctgggccgccgaacatctggagatccagaccgcggac
gccgcggccgtcgccggccgggtccgcaacgccggggccgtgttcgtgggggtatgggca
ccggtgtcgctgggggactatctcgccggctcgaaccacgtcctgccgacgggcggtacc
gcccggcacagcggtgggctttcggtgtcggcgttccaacggcaggttcacgtggtggag
tgcgaccgtgacgctcttgccgaggtggcgcccagaatcgccgcgctcggtggcgccgag
gatctcatcgcccacgtcgacgcggtggaggtgcggctgcgatga

DBGET integrated database retrieval system