KEGG   Frankia symbiont: FsymDg_2637Help
Entry
FsymDg_2637       CDS       T01530                                 

Definition
malate synthase A (EC:2.3.3.9)
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
fsy  Frankia symbiont
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:fsy00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    FsymDg_2637
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    FsymDg_2637
   00630 Glyoxylate and dicarboxylate metabolism
    FsymDg_2637
Enzymes [BR:fsy01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     FsymDg_2637
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3140911..3142536
Genome map
AA seq 541 aa AA seqDB search
MRVAEPGVPFPDVPAGVEITGPVGERFEEILTLPALALVADLERRFGPRRGELLTRRDEV
QAQLSAGANLDFLPHTRDVREGDWQVAPPPPGLLDRRVEITGPTDRKMTINALNSGAKVW
LADFEDANTPLWENMVTGQLNLRDALDRTIDFTSGDGRRYALADTLATIVARPRGWHLTE
KHLLVDGRPVSAGLFDFGLYFFHCAQRQLDAGGGPYFYLPKLESHLEARLWNDVFVHAED
ALGFPRGTIRATVLIETIPAAFEMEEILYELREHSAGLNAGRWDYLFSIIKKFRDRGERF
ALPDRNAVTMTAPFMRAYTDLLVRTCHRRGAHAIGGMAAFIPSRRDAEVNATALARVRAD
KTREAEAGFDGSWVAHPDLVALCREVFDGVLGERPNQLTRTREDVRVSAADLLDVASAPG
ERTLAGLRNNVSVALQYLRAWLRGTGAVAIFNLMEDAATAEIARSQVWQWLRGGVVLDDG
TPVTRELVERIVTEELATLRQTLGEGYDATGFEQARALFTELALADTFTDFLTLPAYDRL
P
NT seq 1626 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgtggccgagcctggcgtcccgttccccgacgttcccgccggtgtggagatcact
ggccctgtcggggaacgcttcgaggagatcctgaccctcccggcgctggcgctggtcgcc
gatctggagcgccgcttcggcccacggcggggtgagctgctgacccggcgcgacgaggtg
caggcccagctgtccgccggcgcgaacctggacttcctcccccacaccagggacgtccgc
gagggcgactggcaggtcgccccgcccccgccgggccttctcgaccgccgggtcgagatc
accgggccgaccgaccgcaagatgacgatcaacgcgctgaactcgggcgcgaaggtctgg
ctggccgacttcgaggacgccaacacccccctgtgggagaacatggtcaccggccagctc
aacctgcgcgacgccctggaccgcaccatcgacttcaccagcggggacggccggcgctac
gccctcgccgacaccctggccacgatcgtggccaggccccgcggctggcacctgaccgag
aaacacctgctcgtcgacggccggcccgtctccgccggcctgttcgacttcgggctgtac
ttcttccactgcgcgcaacggcagctcgacgccggcgggggcccgtacttctacctcccg
aaactggaaagccatcttgaggcgcggctgtggaacgacgttttcgtccacgccgaggac
gccctcggttttccccggggcacgatccgcgccaccgtgctcatcgagacgatcccggcg
gccttcgaaatggaggagatcctctacgagctgcgtgagcattccgccgggctgaacgcg
ggccgctgggactacctgttcagcatcatcaagaagttccgcgaccggggtgagcggttc
gccctgcccgaccgcaacgcggtgacgatgaccgcccccttcatgcgcgcctacaccgac
ctgctggtgcgcacctgccaccggcgcggcgcccacgcgatcggcggcatggccgccttc
atccccagccgccgggacgccgaggtcaacgccaccgccctggccagggtgcgcgcggac
aagacccgcgaggccgaggccggcttcgacggatcctgggtcgcccaccccgacctggtg
gcgttgtgccgggaggtcttcgacggcgtgctcggcgagcgccccaaccagctcacccgc
acccgcgaggacgtgcgggtcagcgccgcggatctcctcgacgtcgcctccgcgcccggc
gagcggacactggcgggcctgcgcaacaacgtcagcgtcgccctccagtacctgcgcgcc
tggctgcggggcaccggcgccgtcgcaatcttcaacctgatggaggacgcggccaccgcc
gagatcgcccgctcccaggtgtggcagtggctgcgcggcggcgtcgtcctcgacgacggc
accccggtgacccgcgagctggtcgaacgcatcgtcaccgaggagctggccacgctccgc
cagaccctcggcgagggctacgacgcgaccggcttcgagcaggcccgcgccctgttcacc
gagctcgccctcgccgacaccttcaccgacttcctgaccctgcccgcctacgaccgcctg
ccgtaa

DBGET integrated database retrieval system