KEGG   Frankia symbiont: FsymDg_2816Help
Entry
FsymDg_2816       CDS       T01530                                 

Definition
(GenBank) Tryptophan synthase alpha chain
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
fsy  Frankia symbiont
Pathway
fsy00260  Glycine, serine and threonine metabolism
fsy00400  Phenylalanine, tyrosine and tryptophan biosynthesis
fsy01100  Metabolic pathways
fsy01110  Biosynthesis of secondary metabolites
fsy01130  Biosynthesis of antibiotics
fsy01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:fsy00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    FsymDg_2816
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    FsymDg_2816
Enzymes [BR:fsy01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     FsymDg_2816
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA KDGP_aldolase PcrB BtpA His_biosynth
Motif
Other DBs
NCBI-ProteinID: AEH10152
JGI: FsymDg_2816
UniProt: F8B5R4
Position
complement(3345814..3346692)
Genome map
AA seq 292 aa AA seqDB search
MRSLSDERSLAGEPSEQSRLSQVFARARADGRAVLVGYLPAGFPSVAGGIAAVRALAEAG
ADVVEVGLPYSDPTMDGPVIQAASDAALRRGVTTADVLRTVEAVAVTGVPALVMTYWNPI
ERYGVDAFARDLAAAGGAGAITPDLPPEEAGPWLAATADAGLDSVFLVAPSSTDARLARV
ATVSKGFIYAASLMGVTGTRERVGAQAADLTRRLRAVTDTPVAVGLGVSTPEQAAEVAGF
ADGVIVGSALVKALLEAERAGADPGEAEVALRGIVTGLATGVRRPEPSVPRG
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
gtgcgaagtctttcggatgaacggagtctcgccggcgagcccagcgagcagagccggctg
agccaggtctttgccagggcgcgcgctgacgggcgggcggtgctggtcggctacctgccg
gcgggcttcccctcggtggccggcgggatcgcggcggtgcgggcccttgccgaggccggg
gcggacgtcgtcgaggtcggcctgccctactcggatccgaccatggacggcccggtgatc
caggccgcgtcggacgcggccctgcgccgcggggtcaccaccgccgacgtcctgcgcacg
gtggaggcggtggccgtcaccggcgtgccggcgctggtgatgacctactggaacccgatc
gagcgctacggggtcgacgcgttcgcgcgtgatctcgcggccgcgggcggggccggcgcg
atcaccccggacctgccgcccgaggaggccggcccgtggcttgcggccaccgccgacgcc
gggctcgactccgtcttcctggtcgcgccgagctcgaccgacgcccggctggcgcgggtc
gccacggtcagcaagggcttcatctacgcggcgtccctgatgggagtgaccgggaccagg
gagcgggtcggcgcgcaggcggccgacctgacccgccggctccgggccgtcaccgacacg
ccggtcgccgtcgggctcggtgtgagcacacccgaacaggcggccgaggtcgccggcttc
gccgacggtgtgatcgtcggatcggccctggtcaaggcgctgctggaggccgaacgtgcc
ggggcggatccgggggaggcggaggtggcgctgcgggggatcgtgaccgggctcgccacc
ggggtacgccgccccgagccgtccgtgccacgggggtga

DBGET integrated database retrieval system