KEGG   Frankia symbiont: FsymDg_2817Help
Entry
FsymDg_2817       CDS       T01530                                 

Definition
Tryptophan synthase subunit beta (EC:4.2.1.20)
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
fsy  Frankia symbiont
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:fsy00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    FsymDg_2817
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    FsymDg_2817
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    FsymDg_2817
Enzymes [BR:fsy01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     FsymDg_2817
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3346852..3348096)
Genome map
AA seq 414 aa AA seqDB search
MTSAVTSAAGLANADAAPVSPVPDSAGHFGRFGGRFVPEALFTALDQLTEAYAAARADPG
FTAELDGLLATYAGRPTALTDAARLTAHVGGARILLKREDLAHTGSHKINNVLGQCLLTR
RMGKTRVIAETGAGQHGVATATACALLGLDCVVYMGEEDTSRQALNVARMRLLGAEVVPV
AAGSRTLKDAINEAMRDWVATVDTTHYCIGSVMGPHPFPMLVRDFQRVIGVEARAQVLER
VGRLPDAVVACVGGGSNAMGIFHPFIDDTSVRLIGAEAGGDGLATGRHAAAIAGGAPGVL
HGMRTFLLQDADGQTQVSHSISAGLDYPGIGPEHAWLHETGRATYGVVDDQAAMDALRLV
ARLEGILVAIESAHAFAAAFDVARDLGPDAVVVVNCSGRGDKDVDTAAKWFDLL
NT seq 1245 nt NT seq  +upstreamnt  +downstreamnt
gtgacctccgccgtgacctccgccgccgggctcgccaacgcggatgccgcgccggtgagc
ccggtgcccgacagtgccgggcacttcggccgtttcggcggccgtttcgtccccgaggcg
ctgttcaccgcgctggaccagttgaccgaggcctacgcggccgcgcgggccgatcccggt
ttcaccgccgaactggacgggctgctcgcgacgtacgccggccggcccaccgcgctcacg
gacgcggcccggctgaccgcgcacgtcggcggcgcccgcatcctgctcaagcgggaggac
ctggcccacaccggctcccataagatcaacaatgtgctcggccagtgcctgctcacccgc
cggatgggcaagacccgggtgatcgccgagaccggcgccggccaacacggggtggccacg
gccaccgcctgcgcgctgctcggcctggactgcgtggtctacatgggcgaggaggacacc
tcccggcaggcgctcaacgtcgcccggatgcggctgctcggcgccgaggtcgtccccgtc
gccgcgggcagccgcaccctcaaggacgcgatcaacgaggccatgcgggactgggtggcc
acggtggacacgacccactactgcatcggctcggtgatggggccgcacccgttcccgatg
ctggtccgcgacttccagcgggtcatcggggtggaggcgcgggcgcaggtgctcgagcgc
gtcggccggctgcccgacgcggtggtggcctgcgtcggcggcggctcgaacgcgatgggg
atcttccatccgttcatcgatgacacctcggtccgcctgatcggcgccgaggccggcggc
gacgggctggccaccggccggcacgcggccgcgatcgccggtggcgctcccggcgttctg
cacggcatgcgcacctttcttctccaggacgccgacgggcagacgcaggtgtcgcactcg
atctcggccgggctggactatccgggcatcggccccgagcacgcctggctgcacgagacg
ggccgggcgacctacggggtggtcgacgaccaggccgccatggacgcgctgcgcctggtg
gcccggctggagggcatcctggtcgcgatcgagagcgcgcacgcgttcgccgccgcgttc
gacgtcgcccgggatctcggcccggacgccgtcgtcgtcgtgaactgctcggggcggggc
gacaaggacgtcgacaccgcggcgaagtggttcgatctcctctga

DBGET integrated database retrieval system