KEGG   Frankia symbiont: FsymDg_3150Help
Entry
FsymDg_3150       CDS       T01530                                 

Definition
acylglycerol lipase (EC:3.1.1.23)
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
fsy  Frankia symbiont
Brite
Enzymes [BR:fsy01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     FsymDg_3150
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3744810..3745601
Genome map
AA seq 263 aa AA seqDB search
MAGVPRRSVTPGTSVVPGAEPFEHDGGDTGVLLIHGFTGTPQSMRPWGTFLAEAGLTVCC
PLLPGHGTRWQEMNGTTWHDWFAAAEDAFIRLRERCSTVFVMGLSMGGTLTLRLAEVYGP
ALTGVATVNPSLGTDRKVAALAPALSRVIPCVVGVGSDIKAAGTAEVAYRRLPLRAFVSL
RELWAVTVADLGRVTSPILTFRSRVDHVVEATSGRILLAGATSSTVSERILENSYHVATL
DNDRHTIFEGSLQFVDTHTVVSR
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atggcaggcgtaccacggcgttcggtcacaccgggtacttcggtcgtacccggtgcggag
ccgttcgaacacgacggcggcgacaccggggtgctgctgatccacggattcacgggcaca
cctcagagcatgcgcccctggggcacgttcctcgcggaggcgggcctgacggtctgttgc
ccgctgctgccgggccacggcacccgctggcaggagatgaacggcacgacctggcacgac
tggttcgcagcggccgaagacgccttcatccgcctgcgggaacgctgctcgaccgtcttc
gtcatggggctgtccatgggcggcaccctgaccctgcggctggcggaggtgtacggcccg
gcgttgaccggagtggccacggtcaaccccagcctcggcaccgatcggaaggtggccgcg
ctcgccccggcgctctcccgcgtgatcccctgcgtggtcggggtgggcagcgacatcaag
gccgcgggtacggcggaggtcgcctaccggcgcctgcccctgcgggccttcgtctccctg
cgcgaactgtgggcggtgacagtggcggacctggggcgtgtcaccagcccgatcctgacc
ttccgcagccgcgtcgaccacgtcgtcgaggccacctccggacggatcctgctggcgggc
gcgacatcgtccaccgtttccgagcgcatcctggagaacagttaccacgtcgcgactctc
gacaacgacagacacacaattttcgagggaagcctccagttcgtcgacacgcacacggtt
gtctcgaggtga

DBGET integrated database retrieval system