KEGG   Frankia symbiont: FsymDg_3153Help
Entry
FsymDg_3153       CDS       T01530                                 

Definition
(GenBank) glucokinase, ROK family
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
fsy  Frankia symbiont
Pathway
fsy00010  Glycolysis / Gluconeogenesis
fsy00052  Galactose metabolism
fsy00500  Starch and sucrose metabolism
fsy00520  Amino sugar and nucleotide sugar metabolism
fsy00521  Streptomycin biosynthesis
fsy01100  Metabolic pathways
fsy01110  Biosynthesis of secondary metabolites
fsy01120  Microbial metabolism in diverse environments
fsy01130  Biosynthesis of antibiotics
fsy01200  Carbon metabolism
Module
fsy_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
fsy_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:fsy00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    FsymDg_3153
   00052 Galactose metabolism
    FsymDg_3153
   00500 Starch and sucrose metabolism
    FsymDg_3153
   00520 Amino sugar and nucleotide sugar metabolism
    FsymDg_3153
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    FsymDg_3153
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    FsymDg_3153
Enzymes [BR:fsy01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     FsymDg_3153
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK Glucokinase FGGY_N BcrAD_BadFG Hydant_A_N
Motif
Other DBs
NCBI-ProteinID: AEH10462
JGI: FsymDg_3153
UniProt: F8B658
Position
complement(3747903..3748889)
Genome map
AA seq 328 aa AA seqDB search
MTPTTSGRDGSQPDLVIGVDVGGTKVAAGVVDGAGAVLSSLRRPTPSQQPSAVADLIGEV
VGELRAAVAPRPVRAVGIGAAGLIDRDRSRVLFAPNLAWRDEPLRDEVSTRTGLPVVVEN
DANAMAWGEYRFGAGRGEPDLVCVTVGTGVGGGIVLDGRLYRGRFGLGGEIGHMQLVTGG
RLCGCGNRGCLEAYGSGNALVRKARELVTTSPTAGRRLLELAGGEVGALTGPAVTEAARE
GDPLAVKCFEDVGTWLGRAMASLASILDPGLFVLGGGVSEAGDLLLAPARVEFANSLSAR
QHRPEARIVTAQLAAWGGIVGAADLTRS
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
gtgacccccacaacgtcgggtagggacggctcacagcccgatctggtgatcggcgtggat
gtcggtggcacgaaggtcgccgcgggtgttgtcgacggggccggggcggttctgtcgtcg
ctgcggcggccgacgccgagccagcagccgtccgcggtggccgatctgatcggcgaggtg
gtcggcgagctgcgagcggccgtggcgccgcggccggtgcgggcggtcggcatcggggcg
gcgggcctgatcgaccgtgaccgctcgcgggtgctgttcgcgccgaacctcgcctggcgt
gacgagccgctacgggacgaggtgagcacccgcaccggtctgccggtcgtcgtggagaac
gacgcgaacgcgatggcctggggggagtaccgcttcggtgccggccgcggcgagccggat
ctggtgtgtgtgacggtgggaaccggtgtcggcggcgggatcgtgctcgacggccggctg
taccgggggcggttcgggctcggcggggagatcgggcacatgcagctggtgaccggcggc
cgtctgtgcgggtgcgggaaccggggatgcctggaggcgtacggtagcggcaacgcgctg
gtccgcaaggcccgtgagctggtgacgacctcgccgacggcgggccggcgcctgctggag
ctcgccggcggcgaggtgggcgctcttactggtccggcggtcaccgaggccgcccgggag
ggtgatccgctcgcggtgaagtgcttcgaggacgtcggtacctggctgggccgggcgatg
gccagcctggcctcgattctcgatcccggtctcttcgtgctcggcggcggggtgtcggag
gctggtgatcttcttctcgccccggcccgcgtggagttcgcgaacagcctgtcggcccgc
cagcaccgtcccgaggcacggatcgtcacagcccagctcgcagcctggggcggcatcgtc
ggcgccgccgacctgacccgtagctga

DBGET integrated database retrieval system