KEGG   Frankia symbiont: FsymDg_3153Help
Entry
FsymDg_3153       CDS       T01530                                 

Definition
ROK family glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
fsy  Frankia symbiont
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:fsy00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    FsymDg_3153
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    FsymDg_3153
   00052 Galactose metabolism
    FsymDg_3153
   00500 Starch and sucrose metabolism
    FsymDg_3153
   00520 Amino sugar and nucleotide sugar metabolism
    FsymDg_3153
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    FsymDg_3153
   00524 Butirosin and neomycin biosynthesis
    FsymDg_3153
Enzymes [BR:fsy01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     FsymDg_3153
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3747903..3748889)
Genome map
AA seq 328 aa AA seqDB search
MTPTTSGRDGSQPDLVIGVDVGGTKVAAGVVDGAGAVLSSLRRPTPSQQPSAVADLIGEV
VGELRAAVAPRPVRAVGIGAAGLIDRDRSRVLFAPNLAWRDEPLRDEVSTRTGLPVVVEN
DANAMAWGEYRFGAGRGEPDLVCVTVGTGVGGGIVLDGRLYRGRFGLGGEIGHMQLVTGG
RLCGCGNRGCLEAYGSGNALVRKARELVTTSPTAGRRLLELAGGEVGALTGPAVTEAARE
GDPLAVKCFEDVGTWLGRAMASLASILDPGLFVLGGGVSEAGDLLLAPARVEFANSLSAR
QHRPEARIVTAQLAAWGGIVGAADLTRS
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
gtgacccccacaacgtcgggtagggacggctcacagcccgatctggtgatcggcgtggat
gtcggtggcacgaaggtcgccgcgggtgttgtcgacggggccggggcggttctgtcgtcg
ctgcggcggccgacgccgagccagcagccgtccgcggtggccgatctgatcggcgaggtg
gtcggcgagctgcgagcggccgtggcgccgcggccggtgcgggcggtcggcatcggggcg
gcgggcctgatcgaccgtgaccgctcgcgggtgctgttcgcgccgaacctcgcctggcgt
gacgagccgctacgggacgaggtgagcacccgcaccggtctgccggtcgtcgtggagaac
gacgcgaacgcgatggcctggggggagtaccgcttcggtgccggccgcggcgagccggat
ctggtgtgtgtgacggtgggaaccggtgtcggcggcgggatcgtgctcgacggccggctg
taccgggggcggttcgggctcggcggggagatcgggcacatgcagctggtgaccggcggc
cgtctgtgcgggtgcgggaaccggggatgcctggaggcgtacggtagcggcaacgcgctg
gtccgcaaggcccgtgagctggtgacgacctcgccgacggcgggccggcgcctgctggag
ctcgccggcggcgaggtgggcgctcttactggtccggcggtcaccgaggccgcccgggag
ggtgatccgctcgcggtgaagtgcttcgaggacgtcggtacctggctgggccgggcgatg
gccagcctggcctcgattctcgatcccggtctcttcgtgctcggcggcggggtgtcggag
gctggtgatcttcttctcgccccggcccgcgtggagttcgcgaacagcctgtcggcccgc
cagcaccgtcccgaggcacggatcgtcacagcccagctcgcagcctggggcggcatcgtc
ggcgccgccgacctgacccgtagctga

DBGET integrated database retrieval system