KEGG   Frankia symbiont: FsymDg_3219Help
Entry
FsymDg_3219       CDS       T01530                                 

Definition
2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide succinyltransferase (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
fsy  Frankia symbiont
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:fsy00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    FsymDg_3219
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    FsymDg_3219
  Amino acid metabolism
   00310 Lysine degradation
    FsymDg_3219
Enzymes [BR:fsy01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     FsymDg_3219
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3811946..3813466
Genome map
AA seq 506 aa AA seqDB search
MPVVHGRSDAAKEPYPMSVSVTMPRLGESVSEGTVTRWLKKEGERVEADEPLLEVSTDKV
DTEIPAPASGVISAIRVAEDETVEVGVELAVIDEGGTAAQAAPAAAAAPAPAPAAPPPPP
PAPAPAPVAAAPPPAPAPPPPPPAPPAPAPVAPPVPAAAQAPPPAVPAQELTPSAPATAS
PANGSGSLGAYVTPLVRRLAAEHDVDLAAVTGTGVGGRIRKQDVIDAARTPASPAAAAPA
APAASPVAVPAAAPAAPAAPAAAPVSLRGRTEKLSRLRSVIAQRMVESLQVSAQLTTVVE
ADVTRIARLRDRAKKAFEAREGVKLSFLPFFAVATCEALREHPNVNASVDIEQGTITYYD
AEHLGIAVDTDRGLLVPVIHHAGDLNLTGMARKIDDLATRTRENRVTPDELGGGTFTLTN
TGSRGALFDTPIINQPQVGILGTGAVVKRPTVVDDPELGEIIAVRSTVYLALTYDHRIVD
GADAARFLTTLRRRLEEGSFEAELGL
NT seq 1521 nt NT seq  +upstreamnt  +downstreamnt
ttgcccgtcgtccacggtcggtcggacgccgcaaaggagccctaccccatgtctgtgtcc
gtcacgatgccccgtctgggtgagagcgtgtccgagggcaccgtcacccgctggctgaag
aaggaaggcgagcgcgtcgaggccgacgagccgctcctcgaggtcagcacggacaaggtc
gacaccgagatccccgcacccgcgtccggcgtgatcagcgctatccgggtggccgaggac
gaaacggtcgaggtcggcgtcgaactcgccgtcatcgacgaaggcggcacggcggcgcag
gccgctccggccgcagccgccgcacccgcacccgcgccggcggccccgccgcctccgccg
cccgcgcccgcgcccgcgccggtggccgcggccccgccgcccgctcccgctccgccgccg
cctccgcccgcgccgccggctccggctccggtcgcgccgccggtgcccgccgcggcccag
gctcccccgccggccgttccggcccaggagctcacaccgtcggcaccggccaccgcctcc
ccggccaacggcagcggctccctcggggcctatgtcactccgctggtccggcggctcgcc
gccgagcacgacgtggacctcgccgcggtgacgggcaccggtgtcggcggccgcatccgc
aagcaggacgtcatcgacgcggcacgcaccccggccagcccggcagcagcggccccggcc
gctcccgctgcctcgccggtggcggtgcccgctgcggcaccggctgcgcctgccgcgccc
gcggcggcaccggtctcgctgcgtggccgcaccgagaagctgtcgcggctacgttcggtg
atcgcgcagcggatggtcgagtccctccaggtcagcgcgcagctcaccaccgtcgtcgag
gccgacgtcacccgcatcgcccggctgcgcgaccgcgcgaagaaggcgttcgaggcgcgg
gagggcgtcaagctgtcgttcctgccgttcttcgcggtcgcgacctgcgaggcgctgcgc
gagcaccccaacgtcaacgccagcgtggacatcgaacagggcacgatcacctactacgac
gccgagcatctgggcatcgccgtggacaccgaccgggggctgctcgtcccggtcatccac
cacgccggtgacctcaacctcaccgggatggcgcgcaagatcgacgatctggcgacccgg
acacgggagaaccgggtcaccccggacgagctcggcggcggcaccttcaccctgaccaac
accggcagccgcggcgccctgttcgacacgccgatcatcaaccagccgcaggtcgggatc
ctcgggaccggcgcggtggtcaagcggcccacggtcgtcgacgaccccgagctcggcgag
atcatcgcggtacgttcgacggtgtacctcgcgctcacctacgaccaccggatcgtcgat
ggcgccgacgcggcccgtttcctcaccaccctgcgcaggcgcctggaggaaggctcgttc
gaggccgaactcggcctgtga

DBGET integrated database retrieval system