KEGG   Frankia symbiont: FsymDg_3312Help
Entry
FsymDg_3312       CDS       T01530                                 

Definition
guanylate kinase (EC:2.7.4.8)
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
fsy  Frankia symbiont
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:fsy00230]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3924342..3924887)
Genome map
AA seq 181 aa AA seqDB search
MRLTVLSGPSGVGKGTVVAEVRRRHPEVWVSVSCTTRAPRPGETNGVEYHFVDVEEFTLM
VKKGELLEHAMFAGHAYGTPRAPLEARLAEGVPCLLEIELQGARQVRAGIPDARFVFLAP
PSWQELVRRLTGRGTEPPEVIERRLDRARTELAAESEFDAVVVNDDVTRAAARLVALMDT
D
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
atgcggctcaccgttctgtccggtccgtcaggcgtcgggaaagggaccgtcgtcgccgag
gtgcgtcgacgccaccccgaggtctgggtttcggtcagttgcacgacacgcgcgccgcgc
ccgggggagaccaacggggtggagtatcacttcgttgatgtcgaggagttcaccctgatg
gtcaagaagggtgagcttcttgagcatgcgatgttcgccggtcatgcctatggaaccccc
cgcgcgccgctggaggcccgtctcgccgaaggggtgccgtgcctgctggaaatcgaactt
cagggcgcccggcaggtacgtgcgggtattcccgacgcccggttcgtcttcctcgccccg
ccgtcctggcaggagctggtccgtcggctcaccggacgcggcacggagccgccggaggtg
atcgaacgccgccttgaccgggcccgcaccgagcttgccgccgaatccgagttcgacgcg
gtggtggtcaacgacgacgtgacccgggcggcggcccggctggtagccctgatggacacc
gactag

DBGET integrated database retrieval system