KEGG   Frankia symbiont: FsymDg_3800Help
Entry
FsymDg_3800       CDS       T01530                                 

Definition
(GenBank) acetate/CoA ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
fsy  Frankia symbiont
Pathway
fsy00010  Glycolysis / Gluconeogenesis
fsy00620  Pyruvate metabolism
fsy00640  Propanoate metabolism
fsy00680  Methane metabolism
fsy01100  Metabolic pathways
fsy01110  Biosynthesis of secondary metabolites
fsy01120  Microbial metabolism in diverse environments
fsy01130  Biosynthesis of antibiotics
fsy01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:fsy00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    FsymDg_3800
   00620 Pyruvate metabolism
    FsymDg_3800
   00640 Propanoate metabolism
    FsymDg_3800
  Energy metabolism
   00680 Methane metabolism
    FsymDg_3800
Enzymes [BR:fsy01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     FsymDg_3800
Lipid biosynthesis proteins [BR:fsy01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   FsymDg_3800
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: AEH11077
JGI: FsymDg_3800
UniProt: F8B552
Position
complement(4456266..4458287)
Genome map
AA seq 673 aa AA seqDB search
MTSTADGTGLDAVGTDIVGTDDVSLERELDQLLAVERFDPPPDFVSRWYRPADAAAAAAD
PPAFWAEQARTLLDWDTPFTTVLDDSNPPFYRWFTDGRLNVSANCLDRHVAAGRGDKVAI
HWVGEEGERRRVTYSDLLADTQRLANGLKELGVGKGDVVGIFLPMIPEVAVAMLACARIG
AVHNVVFGGFAPSAVRERMEVSDAKVLITVDGARRKGRTAPVKEAVDAELGDLKALEHIV
VVRSTGIAAPIREGRDVWYHELLERADPVAPPEPLDAEHPLFILYSSGSTAKPKGILHTT
GGYLTGATYTHRLVFDLDADSDVYWCSADVGWITGHSYIVYGPLSNGATSVMFEGAPDYP
DRDIWWKIIEECKVTIFYTAPTAIRTCIKWGPQYPGRHDLSSLRLLGTVGEPINPKAWLW
YHKVIGGGRCPIVDTWWQTETGAILISPLPGVTSTKPGSATTPLPGIFPALLSEDGQPVT
EGTGVLVITKPWPSMLRTLYRDDERYVQTYFSRFGRDVYVVGDAARLDADGYFWIIGRID
DVINVSGHRLSTAEVESAIVSHELVAEAAVVAQSDEQTGQAIVAFVTLTGNQSGDDATIA
ELREHVATRIGKLARPKRVIWADDLPKTRSGKIMRRLLRDIAEGRELGDVTTLRDPDVVA
ALAGKVAQADADE
NT seq 2022 nt NT seq  +upstreamnt  +downstreamnt
gtgaccagcacggcggacggtaccggtctggacgctgtcggtactgacatcgtcggtacc
gacgatgtcagcttggagcgcgaactcgaccaactgctggcggtggagcgtttcgacccg
ccgcccgacttcgtctcccgctggtatcggcccgccgatgccgccgcggccgccgccgac
ccgccggctttctgggcggagcaggcccgcaccctgctggactgggacacgccgttcaca
accgtgctggacgacagcaacccgcccttttaccgctggttcaccgacggccggctcaac
gtctcggcgaactgcctggaccggcacgtggccgccggccgcggggacaaggtggccatc
cactgggtcggtgaggagggcgaacgccgccgggtgacctactccgacctgctggccgac
acccagcggctggccaacgggctcaaggagctaggggtcggcaagggcgacgtcgtgggg
atcttcctcccgatgatccccgaggtcgcggtggccatgctggcctgcgcccgcatcggc
gcggtgcacaacgtcgtcttcggtggcttcgccccgtccgccgtgcgtgagcggatggag
gtctccgacgccaaggttctgatcacggtggacggagcccgccgcaagggccgcaccgcc
cctgtcaaggaggccgtggacgccgagctgggcgatctgaaggccctggagcacatcgtg
gtggtccgctccaccgggatcgcggcgccgatccgcgagggccgggacgtctggtaccac
gagctgctcgagcgggccgacccggtggccccgccggagccgctggatgccgagcatccg
ctgttcatcctgtacagctccggttccacggccaagcccaagggcatcctgcacaccacc
ggggggtacctgaccggggcgacctacacccaccggctggtcttcgacctcgacgcggac
tccgacgtctactggtgctcggcggacgtcggctggatcaccggccactcctacatcgtc
tacgggccgttgtccaacggcgcgaccagtgtgatgttcgagggtgccccggactatccc
gaccgggacatctggtggaagatcatcgaagagtgcaaggtcacgatcttctataccgct
ccgaccgccatccggacctgcatcaagtggggcccgcagtacccgggccggcacgacctc
tcctcgctgcggctgctcggcacggtgggggagccgatcaaccccaaggcgtggctgtgg
taccacaaggtgatcggcggcggccgttgccccatcgtcgacacctggtggcagaccgag
accggcgccatcctgatctccccgttgcccggtgtgacgtcgaccaagccgggttcggcc
accacgccgctgccggggatcttccccgccctgctgtccgaggacggccagccggtgacc
gagggcaccggcgtcctggtgatcaccaagccgtggccgtccatgctgcgcaccctctac
cgggacgacgagcggtacgtgcagacgtacttctcccgcttcggccgggacgtgtacgtc
gtcggcgacgccgcccggctggacgcggacggctacttctggatcatcggccggatcgac
gacgtgatcaacgtgtccgggcaccggctgtcgaccgccgaggtcgagtcggcgatcgtc
tcgcacgagctggtggcggaggccgcggtcgtcgcccagtccgacgagcagaccggccag
gccatcgtggccttcgtcacgctcaccggcaaccagtccggggacgacgccaccatcgcc
gaactgcgcgagcacgtcgccacccggatcggcaagctcgctcgccccaagcgggtgatc
tgggcggacgacctgcccaagacccggtccgggaagatcatgaggaggctgctgcgggac
atcgccgaggggcgcgagctcggcgacgtcacgacgctgcgggatccggacgtggtggcc
gccctggcaggcaaggttgcccaggccgacgcggacgagtga

DBGET integrated database retrieval system