KEGG   Frankia symbiont: FsymDg_3817Help
Entry
FsymDg_3817       CDS       T01530                                 

Definition
1,4-alpha-glucan-branching protein (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
fsy  Frankia symbiont
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Brite
KEGG Orthology (KO) [BR:fsy00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    FsymDg_3817
Enzymes [BR:fsy01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     FsymDg_3817
Exosome [BR:fsy04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   FsymDg_3817
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4482736..4485324
Genome map
AA seq 862 aa AA seqDB search
MSMIGPDGAAGGVDEGQPGSCRRDASGPPSDASSGLARSPLPAMAMAGHGGGRRGNDHDD
AGYDDARYSEGGGYPETAYRDGGRDRGEHTAAQHDRAERGTTGQSGAERDAGGQDAPASS
PPSLLVDTAELERLVNGSHHDPHHILGAHPHGDWTIVRALRPDAVGVVVITENERFECTR
LHTAGVFAVALPTGAVPGYRLEVQYCDATHVVDDPYRHLPTLGEMDLHLIGEGRHEQLWK
ALGARVRRYPDSTGTAEVSGVGFAVWAPNARGVRVVGDFDFWDGRAYPMRSLGATGVWEL
FVPGIGAGCRYKYEILGFDGVWRQKADPLALHTENPPATASVVFESDYTWSDEAWLARRR
RTAWHAMPISVYEVHLGSWRRGLSYRQLATELVAHVREMGFTHVELLPVAEHPFGGSWGY
QVSAYYAPTSRFGDPDDFRYLVDQLHQAGIGVIVDWVPAHFPRDVWALGRFDGTPLYEHP
DPRRGEQPDWGTYVFDFGRPEVRNFLVANAVYWFEEFHIDGLRVDAVASMLYLDYSRAEG
EWIPNIHGGRENLDAVSFLQETNATVYRRVPGVMMIAEESTAWPGVTRPTHLGGLGFGFK
WNMGWMHDTLDYLSRAPVFRVYHHHQMTFSMMYAYSENFVLPLSHDEVVHGKGSLLRKMP
GDRWQQLANLRALYGYMWAHPGKQLLFMGGEFAQEAEWSEARSLDWWHLDDPDHRGVATL
LKDLNGAYRATPALWERDISPEGFSWIDANDAENNVFSFLRWASTGPAGGPAGGAATGGR
VIACVTNFSGVPHTGYQLGLPFAGRWRELINTDATEYAGSGLGNLGSVLAVEAARHNQPA
SVTLTLPALSTLWLCYEGAAQN
NT seq 2589 nt NT seq  +upstreamnt  +downstreamnt
ttgtccatgatcggtcctgacggcgcggcaggtggagtcgacgagggccagccaggcagt
tgtcgtcgcgacgccagcggtcctccgagtgacgccagctccgggctcgcccgttccccg
ctgccggccatggccatggccggacacggcggcggccgccggggcaacgaccacgacgac
gccggatatgacgacgccaggtattccgagggcggcggatatcccgaaacggcctaccgg
gacggcggacgcgaccgcggcgagcacaccgcggcccagcacgacagggcggaacggggc
acgaccgggcagagcggggcggagcgggacgccggcggccaggacgccccggcgtcgtcc
cccccgtccctgctcgtcgacaccgccgaactcgagcggctggtgaacggctcgcaccac
gatccgcatcacatcctcggcgcccatccccacggcgactggacgatcgtgcgggccctg
cggccggacgcggtgggcgtggtcgtcatcaccgagaacgagcggttcgagtgcacccgg
ctgcacacggccggggtgttcgccgtggcgctgccgaccggcgccgtccccggctaccgg
ctggaggtccagtactgcgacgccacgcacgtcgtcgacgacccctaccgccacctgccc
accctcggggagatggacctccacctcatcggtgagggccgccacgaacagctgtggaag
gcactcggcgcacgggtgcgccgctacccggacagcaccggcacagccgaggtcagcggg
gtcggtttcgccgtgtgggcgccgaacgcccgcggggtgcgggtggtcggcgacttcgac
ttctgggacggccgggcctacccgatgcgctcgctgggagcgaccggcgtctgggagctg
ttcgtacccggcatcggcgccggctgccggtacaagtacgagatcctcggcttcgacggt
gtctggcggcagaaggccgacccgctcgcgctgcacaccgagaacccgccggccacggcg
agcgtcgtcttcgagtccgactacacctggagtgacgaggcgtggctggcgcggcgcagg
cgcaccgcgtggcacgccatgccgatctcggtctacgaggtgcacctgggttcctggcgc
cgagggctgtcgtaccgccaactcgccaccgagctcgtcgcccacgtgcgggagatgggc
ttcacccacgtcgagttgctgcccgtggccgagcatcccttcggtggttcgtggggctac
caggtgtcggcctactacgccccgacgtcgcggttcggcgaccccgacgacttccgctac
ctcgtcgaccagctccaccaggccggcatcggtgtgatcgtcgactgggtgccggcgcac
ttcccccgggacgtctgggcgctgggccgcttcgacggcaccccgctgtacgagcacccc
gacccccgccgcggcgaacagcccgactgggggacgtacgtgttcgacttcgggcgtccc
gaggtgcgcaacttcctggtcgcgaacgcggtgtactggttcgaggagttccacatcgac
gggctgcgggtggacgccgtcgcctccatgctctacctggactactccagggccgagggc
gagtggatccccaacatccacggtggccgggagaacctggacgcggtgtcgttcctgcag
gagaccaacgccacggtctaccggcgcgtcccgggggtgatgatgatcgccgaggagtcg
acggcctggccgggggtgacccgcccgacgcatctggggggtctgggcttcggtttcaag
tggaacatgggctggatgcacgacacgctcgactacctctcccgggcgccggtgttccgc
gtgtaccaccaccatcagatgaccttctccatgatgtacgcgtactcggagaacttcgtc
ctcccgctcagccacgacgaggtggtgcacgggaagggctcgctgctgcgcaagatgccc
ggtgaccgctggcagcagctggccaacctgcgcgcgctctacggctacatgtgggcgcac
ccgggcaagcagctgctgttcatgggcggggagttcgcccaggaggccgagtggtccgag
gcccggtcgctggactggtggcacctggacgacccggaccaccggggtgtggccacgctg
ctgaaggacctcaacggtgcctaccgggccacccccgccctctgggaacgagacatctcc
ccggaggggttctcctggatcgacgcgaacgacgccgagaacaacgtgttctcgttcctg
cggtgggcctccaccggcccggctggcggcccggctggcggtgccgcgacgggcgggcgg
gtaatcgcctgcgtcaccaacttctccggtgtcccccacaccggctaccagctcgggctg
ccgttcgccggccgctggcgtgagctcatcaacaccgacgccaccgagtacgccggcagc
gggctggggaacctgggttccgtgctcgctgtggaggccgcccgccacaaccagccggcg
tcggtgacgctcaccctgcccgccctgagcaccctgtggctgtgctacgagggcgccgcc
cagaactga

DBGET integrated database retrieval system