KEGG   Frankia symbiont: FsymDg_3870Help
Entry
FsymDg_3870       CDS       T01530                                 

Definition
Agmatinase (EC:3.5.3.11)
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
fsy  Frankia symbiont
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fsy00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    FsymDg_3870
Enzymes [BR:fsy01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     FsymDg_3870
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4537927..4538850
Genome map
AA seq 307 aa AA seqDB search
MHTKVVDDPTICWVADSWVDQTTPDDAVFSFLRIPFDYAVSHRPGTRFGPEGIRTAFNGF
SLYCTDKRVSLDHVRLVDLGRVDVVHSLPETYANITEAVAGIPPEQHPVFLGGDHSIADP
IFRGLLRRNPGRRFGLIVFDAHFDARPPIPRKEHSGHWMKTLEDVIDYSVTAQPGISAPI
YSEYYMRSAEEQGVLVRTPYEIRRRGWWETLEEAISHVSRDTDGVYISVDIDCLDQAFAP
GTSVPNGSGLLTHEVADAVFEISGAVPVVGIDINEVSPPLDRLDQISQLAAHLLLNHMAG
VVAGKWA
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atgcacacgaaggtcgtcgacgacccgacaatatgctgggtcgccgacagctgggtcgac
cagaccacgccggacgacgccgtcttctcgttcctgcggatcccgttcgactacgcggtg
agccatcgaccgggaacccgtttcgggcccgagggcattcggaccgcgttcaacgggttc
tccctctactgcaccgataaaagagtctcgctggaccacgtccgactggtcgacctcggc
cgggtcgacgtcgtccactcgctgccggaaacctacgcgaatatcaccgaagccgtggcc
ggaattcccccggaacagcatccggtctttctcggtggtgaccactcgatcgccgacccg
attttccgcggcctgctccggcggaacccgggccggcgattcggactgatcgttttcgac
gcccatttcgacgcccgcccgccgatccccaggaaggaacactcgggccactggatgaag
accctggaagatgtcatcgactactcggtgaccgcccagcccggcatcagcgcccccatc
tactccgagtactacatgcgttccgcggaggagcagggggtgctcgtccgcacgccctac
gagatccgtcggcgtggctggtgggagactctggaagaagcgatcagccatgtgtcccgg
gacaccgacggcgtgtacatctccgtcgacatcgactgcctggaccaggcgttcgcaccc
ggcaccagcgtcccgaacggcagcggtctgctcacccacgaggtggcggacgccgtcttc
gagatcagcggcgccgtccccgtggtgggcatcgacatcaacgaggtgagtcccccgctg
gaccgcctcgaccagatctcccagctcgcggcccatctgctcctcaaccacatggccggt
gtcgtcgccggcaagtgggcctga

DBGET integrated database retrieval system