KEGG   Frankia symbiont: FsymDg_4015Help
Entry
FsymDg_4015       CDS       T01530                                 

Definition
(GenBank) uroporphyrin-III C-methyltransferase
  KO
K13542  uroporphyrinogen III methyltransferase / synthase [EC:2.1.1.107 4.2.1.75]
Organism
fsy  Frankia symbiont
Pathway
fsy00860  Porphyrin and chlorophyll metabolism
fsy01100  Metabolic pathways
fsy01110  Biosynthesis of secondary metabolites
fsy01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:fsy00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    FsymDg_4015
Enzymes [BR:fsy01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.107  uroporphyrinogen-III C-methyltransferase
     FsymDg_4015
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     FsymDg_4015
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TP_methylase HEM4
Motif
Other DBs
NCBI-ProteinID: AEH11289
JGI: FsymDg_4015
UniProt: F8AVI3
Position
complement(4709840..4711870)
Genome map
AA seq 676 aa AA seqDB search
MNGPERSHGEVWLVGAGPGDPGLLTVRGRELLGAADVVVTDRLVSTDVLGYVRPEAEIVY
SGKSAGALTRTQEGINALLVERALAGRRVVRLKGGDPFLLGRGGEEAEACRLAGVRCTVV
PGVPSAFAAPAYAGIPVTHRGVAQDVAVVSGHLRPGHPDSTVDWAALGASRMTIVVLMGV
ARLADVTAALIEGGRSPDTPVAVIERATTPAQRVVRGTLDTIVVDAVARGVRSPAVVVIG
DVAARHDAVPRILPPPDSDNHGCRPRAVNGDGSLAGTGTGTGTGGNGAGPSDANNRPDRA
TVRPRFWNGAGPGDTDSPDGDTASLRNPNIYATTDSCDDSRGFAAGSPAVDAGAGRPLAG
VRVLVPRTRPRPGLLATRLRALGADAVESTVSRPGPVADPAPLLAALTDADALVLAGVAE
VAAVVALLRRAGHDIRALAGLVLVAADAEAEVALEALGLACVRPPVSACDAGPAGSSEPA
DPRGAQPRTVEPTGTQRAGSSADVRGTGSVGARSTESADVRSTEPSRGRDRRRLPLGSGV
VSGSVRVVVCASASPPAGAETVRRISLLTDVDAEPDPRIVEEIRHGDLHAVAFASSTAVR
ATVALYGSLPDGIMVAAIGRRTVEACRHAGVRVDAVATEPGIHPLAAAVADAVTRARSAE
ASASQRGSVPKSIKNR
NT seq 2031 nt NT seq  +upstreamnt  +downstreamnt
gtgaacggtccggagcgctcccacggcgaggtctggctggtcggggcagggcctggtgat
ccagggttgctcactgtccgcggtcgggaactgctcggtgcggccgatgtcgtcgtcacc
gatcgcctggtgtccactgacgttctcggatacgtccggcccgaggcggagattgtttac
agcggcaagagcgctggcgcgcttactcgcacccaggagggcatcaacgcgctgctggtc
gaacgggcactcgcgggccgcagggtcgtccggctcaagggcggggacccgttcctgctc
ggccgtggcggcgaggaggcggaagcgtgccggctcgccggggtgcgctgcaccgttgtc
ccgggagtgccctcggcgttcgcggcccccgcctatgcaggtattccggtcacccaccgt
ggcgtcgcgcaggatgtcgcggtcgtctccggtcatctgcggccagggcatcccgactcc
accgtcgactgggcggcactcggcgcgtcccggatgaccatcgttgtgctgatgggggtt
gcccggctcgccgacgtcaccgcggccctcatcgagggcgggcggtcacccgacacgcct
gtcgcggtgatcgaacgcgccaccacgccggcgcagcgggtcgtgcgcggcaccctcgac
acgatcgtggtcgacgcggttgcgcggggtgtgcgatcaccagctgttgtggtgatcggt
gacgtcgcggcccgtcacgacgcggtaccccggatcctcccgcctccggacagcgacaac
cacggctgccgtccccgtgctgtcaacggcgacggcagcctcgccggcaccggcaccggc
accggcaccggtggcaacggtgcgggccccagcgacgccaacaaccggccggaccgggcg
acggtgagaccgcgcttctggaatggagccggccccggtgacaccgacagccccgacggt
gacactgccagcctccgcaatcccaacatttacgccacaacggacagttgtgatgattcg
cgtggattcgccgccggctcgccggctgtggacgccggtgccggccgtccgctggcggga
gtccgggttctcgtcccgcggacgagaccgcgtcccgggctgttggccacccggttgcgc
gcgctcggcgcggacgccgtggagagcacggtctcgcgtcccgggccggtggccgacccg
gcgccgctgctggctgcgctcaccgacgcggacgcgctggtgctggcgggcgtcgcggag
gtcgcggcggtggtcgcgctgctgcgccgggcgggccacgacatccgggcgcttgccggg
ctcgtgctggtggccgccgacgccgaggcggaggtcgcgttggaggcccttgggctggcc
tgcgtccggccgcccgtcagcgcctgtgacgcggggcccgccggtagttcggagccagcc
gacccccgcggcgcacagccacggaccgtggagcccaccggcacgcagcgggcgggatca
tccgctgacgtgcggggcacgggctctgtcggtgcgcggagcacggagtccgctgatgtg
cggagcacggagccttcccgcgggcgggacaggcgccggctgccactcggctccggggtg
gtgagtggcagcgtccgggtggtggtgtgcgcgtccgcgtcgccgcccgccggagcggaa
acagtgcgtcggatcagcctcctgaccgatgtcgacgccgaacccgatccgcggatcgtc
gaggagatccggcacggcgatctgcacgcggtggcgttcgcgtcgtcgaccgctgtccgc
gcgaccgtcgcgctgtacggctccctaccggatgggatcatggtggccgcgatagggcgg
cgcaccgtcgaggcctgccggcacgccggcgtccgggtggacgcggtggcgaccgaaccc
ggcatccatcccctggccgcggcggtcgccgacgccgtcaccagggcccgctcggctgaa
gcgtcagccagccaacgcggatccgtcccgaaatcaatcaaaaacagatga

DBGET integrated database retrieval system