KEGG   Frankia symbiont: FsymDg_4047Help
Entry
FsymDg_4047       CDS       T01530                                 

Definition
porphobilinogen synthase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
fsy  Frankia symbiont
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:fsy00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    FsymDg_4047
Enzymes [BR:fsy01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     FsymDg_4047
Exosome [BR:fsy04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   FsymDg_4047
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4747902..4748990)
Genome map
AA seq 362 aa AA seqDB search
MSVPPGVTAGAGTTGPTASPAPSPGAGALSAAPGGGAGFPLARPRRLRRGAPLRRLVADV
RLHPADLVLPLFVKEGIDAPAPIASMPGVVQHARESLRKAAVEAARAGVGGLILFGVPAR
KDGRGSAADDPSGIVQLALADLVTEIGNDMVIMTDLCLDEYTDHGHCGLLTEDGEVDNDA
TLARYASIALAQARAGAHVVAPSGMMDGQVGAIRAALDGGGFSHVPVLAYSAKYASAFYG
PFRDAAECAPSFGDRAGYQQDPARSVGEALREVALDLVEGADAVMVKPALAYLDVLRAVA
DAVDVPVAAYQVSGEYAMVEAAAASGWIDRERAITETLIAVRRAGADIILTYWATEAAHR
LR
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgtgccgccgggcgtcaccgccggtgcgggcacaacggggccaactgcctcgcct
gcgccgtcacccggggccggcgccctgagcgccgcccccggtgggggcgcgggattcccg
ctggcccggccccgtcgactgcgccgcggggcaccgttgcgccggctggtggccgacgtc
cggctgcatcctgcggatcttgtgttgccgctgttcgtcaaggagggcattgacgccccc
gcgccgatcgcctcgatgcctggggtcgtccagcacgcccgggagtcgttgcgcaaggcc
gcggtggaggcggcccgcgccggcgtcggcggcctgattctcttcggcgtgcccgcgcgc
aaggacgggcgcggctcggccgcggacgacccgtccggcatcgtgcagctcgccttggcc
gacctggtcaccgagatcggcaacgacatggtgatcatgacggatctctgcctggacgag
tacaccgaccacggccactgcggcctgctgaccgaggacggcgaggtcgacaacgacgcc
accctggcccgctacgcgtcgatcgccctggcgcaggcccgcgccggcgcccacgtggtg
gctccgagcgggatgatggacgggcaggtcggcgcgatccgggcggcactcgacggcggc
ggcttctcccacgtcccggtccttgcctactcggcgaagtatgcgtcggcgttctacggc
ccgttccgggacgcggccgagtgcgcgccgagcttcggcgaccgcgccggctaccagcag
gatccggcccgttccgtcggcgaggccctgcgtgaggtcgccctcgacctcgtcgagggc
gccgacgccgtgatggtgaagccggcgctggcctacctcgacgtgctgcgggcggtcgcc
gacgccgtggacgtgccggtcgccgcctaccaggtctccggcgagtacgcgatggtggag
gcggcggcggccagcggctggatcgaccgcgagcgcgccatcaccgagacgctcatcgcc
gtccgccgggcgggcgcggacatcatcctgacctactgggcaacggaagcggcccaccgc
ctgcgctga

DBGET integrated database retrieval system