KEGG   Frankia symbiont: FsymDg_4069Help
Entry
FsymDg_4069       CDS       T01530                                 

Definition
2,3-bisphosphoglycerate-independent phosphoglycerate mutase (EC:5.4.2.4)
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
fsy  Frankia symbiont
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:fsy00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    FsymDg_4069
   01230 Biosynthesis of amino acids
    FsymDg_4069
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    FsymDg_4069
  Energy metabolism
   00680 Methane metabolism
    FsymDg_4069
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    FsymDg_4069
Enzymes [BR:fsy01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     FsymDg_4069
Exosome [BR:fsy04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   FsymDg_4069
  Exosomal proteins of melanoma cells
   FsymDg_4069
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4773200..4773937)
Genome map
AA seq 245 aa AA seqDB search
MPTLVLLRHGESTWNRENLFTGWVDVDLSDKGRQEAARGGELLRDAGVLPDMVHTSLLLR
AIRTAWIALDTAGRTWIPVHRSWRLNERHYGGLQGLNKAETLAEYGEEKFTLWRRSYDTP
PPPIGPNQVSGVDERYADLPPDLVPTTECLKDVVTRILPYWYDAIVPDLRRGRTVLVAAH
GNSLRALVKHLDGISDSDIAALNIPTGIPLRYELDDDLRVLASSYLDPEEAARAAAAVAA
QGRKK
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
atgccgacgctcgttctgctccgccacggcgagagcacgtggaaccgagaaaacctgttc
accggctgggtggatgtcgacctttccgacaagggccgccaggaggcggcccgcggcggt
gaactgctgcgtgacgcgggtgtgctcccggacatggtgcacacgtcgttgctgctgcgc
gcgatccgcaccgcctggatcgcgctcgacacggccggccggacatggatccccgtgcac
cgctcctggcgcctgaacgaacggcactacggcggcctgcaggggctgaacaaggccgag
accctggccgagtacggcgaggagaagttcacgctgtggcgccgttcctatgacacccca
ccgccgcccatcggccccaaccaggtcagtggtgtggacgagcgctacgccgacctgccg
ccggacctcgtcccgacgaccgagtgcctcaaggacgtggtgacccggatactgccgtac
tggtacgacgcgatcgtgccggacctgcggcgcgggaggaccgtgctcgtcgccgcccac
ggcaactcgctgcgtgccctggtcaagcacctggacggcatcagcgacagcgacatcgcc
gccctgaacatccccaccggcatccccctgcgctacgaactggacgacgacctgcgcgtc
ctggcctcgtcctacctggacccggaggaagcggccagagccgccgccgccgtagccgcc
cagggcaggaagaagtaa

DBGET integrated database retrieval system