KEGG   Frankia symbiont: FsymDg_4131Help
Entry
FsymDg_4131       CDS       T01530                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
fsy  Frankia symbiont
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:fsy00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    FsymDg_4131
   00052 Galactose metabolism
    FsymDg_4131
   00500 Starch and sucrose metabolism
    FsymDg_4131
   00520 Amino sugar and nucleotide sugar metabolism
    FsymDg_4131
Enzymes [BR:fsy01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     FsymDg_4131
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4834152..4835081
Genome map
AA seq 309 aa AA seqDB search
MSVKKAVIPAAGLGTRFLPATKSLPKEMLPVVDRPAIEYVVEEASRAGLRDVLLVTSRTK
KAVEDHFDREAELEAALERKGDTTRLGRIRASAELAEVHSVRQQAPRGLGHAVLCAAGHV
GDEPFAVLLGDDLIDERDPLLVEMLAVRERFGGSVVGLMEVPEDLVSLYGVATVDPTAVG
PAGERYQTVRIRDLVEKPPVDEAPSNLAIIGRYVLSPAVFDVLRQTPPGRGNEIQLTDAL
RTLAHLGDDAGEPVHGVVFTGRRYDTGDRVDYLKAVIRLACERPDIGGELYPWLEEYVSA
GGPKADPGP
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgtcagtgaagaaggcggtgattccggccgcgggcctcggcaccaggttcctgccggcg
accaagtccctacccaaggagatgctcccggtcgtcgaccggccagccatcgagtatgtg
gtggaggaggcttcccgcgccggtctgcgggatgtgcttcttgtcacgagccgcaccaag
aaggcggtggaggaccatttcgaccgggaggccgaactcgaggcggccctggaacgcaag
ggtgacacgacccggctggggcgcatccgcgcgtcggccgagctcgccgaggtgcactcg
gtccgccagcaggccccgcgggggctcggccatgccgtgctgtgcgcggccgggcacgtc
ggcgacgagcccttcgcggtcctgctcggcgacgacctgatcgacgagcgtgatccgctg
ctggtggagatgctcgcggtgcgggagcgtttcggcggcagcgtcgtcggtctcatggag
gttccagaagatcttgtctcgttgtacggggtggcgacggtcgacccgacggccgtcggg
ccggcgggggagcgctaccagaccgtccgcatccgggacctggtggagaagcccccggtc
gacgaggcgcccagcaacctcgcgatcattggccggtacgtcctgtcaccagcggtcttc
gacgtgttgcggcagacgccgcccggccgcgggaacgagatccagctcaccgacgccttg
cggacgctggcccacctcggcgacgatgcgggcgagcccgtccacggagtggtcttcacc
ggacgccggtacgacaccggtgaccgggtggactatctcaaggccgtgatccggctcgcc
tgcgagcggccggacatcggcggggagctctacccgtggctggaggagtacgtctccgcc
ggcggccccaaggcggaccccggtccgtga

DBGET integrated database retrieval system