KEGG   Frankia symbiont: FsymDg_4437Help
Entry
FsymDg_4437       CDS       T01530                                 

Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
fsy  Frankia symbiont
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:fsy00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    FsymDg_4437
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    FsymDg_4437
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    FsymDg_4437
Enzymes [BR:fsy01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     FsymDg_4437
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
5183230..5184504
Genome map
AA seq 424 aa AA seqDB search
MTVAPERVTTISPDVVNPAVSLSCRHCGAAYPLSPTHVCIECFAPLEIAYDDSALRRVTR
ESIEAGPTSLWRYVGLLPAGHDPARRVSLGAGWTPLRPATRLAAELGMRTLWVKDDTANP
THSFKDRVVSVALSAAREHGYTTVACASTGNLAQSVAAHAASAGLRSVVLIPHDLEDGKT
VSTAVYGGTLVAIEGNYDDVNRLCSELSGEYEWAFVNVNVRPFYAEGSKTLGYEVAEQLG
WRLPEQVVVPIASGSLLTKIDKAFGELGRLGLVEPTPYRVFGAQAQGCNPVAAAFARGVD
TVAPVKPSTIAKSLSIGNPADGPYALDVARRTGGAITDVTDSEIVEGIRLLARTEGVFGE
TAGGVTVACLRRLLREGLLDPDAETVIFNTGDGLKTLDPLIPTGRPTATIRPSLSAFEAA
GLGD
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atgacagtcgcccccgagcgcgtcacaacgatcagccccgatgtcgtcaatcccgcggtt
tccctgtcgtgtcgccactgtggtgccgcctatccgctctccccgacgcatgtctgtatc
gagtgtttcgccccgctggagattgcctacgacgactccgcgctgcgccgggtcacccgg
gagtccatcgaagccggccccaccagcctgtggcgctatgtcgggttgttgcccgccggt
cacgaccccgcacgcagggtgtccctcggggcgggctggacgccgctgcgcccggccacc
cgcctcgccgccgagctcggaatgcggacactgtgggtcaaggacgacaccgcgaacccc
acccactcgttcaaggacagggtcgtgtcggtggcgctgtcggccgcgcgcgagcacggg
tacaccacggtcgcctgcgcgtccaccggcaacctggcccagtcggtggcggcgcacgcc
gcgtccgccgggctgcgctcggttgtgctgatcccgcacgatctcgaggacggcaagacc
gtgtcgaccgccgtctacggcggcacgctggtcgcgatcgagggcaactacgacgacgtc
aaccgcctgtgcagtgagctctccggtgagtacgagtgggcgttcgtcaacgtcaacgtg
cggccgttctacgctgagggctccaagacgctcggctacgaggtcgccgaacagctcggc
tggcggctgccggagcaggtcgtggtgccgatcgcgtccgggtcgctattgacgaagatc
gacaaggcgttcggtgagctcggccggctcggtctggtggagccgaccccgtaccgggtc
ttcggcgcgcaggcccagggctgcaacccggtcgcggcggccttcgcccgcggggtggac
acggtcgcgccggtgaagccgtccaccatcgccaagtcgctgtcgatcggcaaccccgcg
gacggcccgtacgcccttgacgtggcccgtcgcaccggcggcgcgatcaccgacgtcacc
gactccgagatcgtcgagggaatccgcctgctggcccggaccgagggcgtcttcggcgag
accgcgggcggcgtcaccgtcgcctgcctgcggcggctgctgcgcgagggcctgctcgac
cccgacgccgagaccgtcatcttcaacaccggcgacggcctgaagaccctcgacccactg
atcccgacaggccggccgaccgcgaccatccgcccctccctgagcgccttcgaagccgcc
ggcctcggcgactga

DBGET integrated database retrieval system