KEGG   Frankia symbiont: FsymDg_4437Help
Entry
FsymDg_4437       CDS       T01530                                 

Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
fsy  Frankia symbiont
Pathway
fsy00260  Glycine, serine and threonine metabolism
fsy00750  Vitamin B6 metabolism
fsy01100  Metabolic pathways
fsy01110  Biosynthesis of secondary metabolites
fsy01120  Microbial metabolism in diverse environments
fsy01230  Biosynthesis of amino acids
Module
fsy_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:fsy00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    FsymDg_4437
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    FsymDg_4437
Enzymes [BR:fsy01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     FsymDg_4437
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: AEH11687
JGI: FsymDg_4437
UniProt: F8AZE9
Position
5183230..5184504
Genome map
AA seq 424 aa AA seqDB search
MTVAPERVTTISPDVVNPAVSLSCRHCGAAYPLSPTHVCIECFAPLEIAYDDSALRRVTR
ESIEAGPTSLWRYVGLLPAGHDPARRVSLGAGWTPLRPATRLAAELGMRTLWVKDDTANP
THSFKDRVVSVALSAAREHGYTTVACASTGNLAQSVAAHAASAGLRSVVLIPHDLEDGKT
VSTAVYGGTLVAIEGNYDDVNRLCSELSGEYEWAFVNVNVRPFYAEGSKTLGYEVAEQLG
WRLPEQVVVPIASGSLLTKIDKAFGELGRLGLVEPTPYRVFGAQAQGCNPVAAAFARGVD
TVAPVKPSTIAKSLSIGNPADGPYALDVARRTGGAITDVTDSEIVEGIRLLARTEGVFGE
TAGGVTVACLRRLLREGLLDPDAETVIFNTGDGLKTLDPLIPTGRPTATIRPSLSAFEAA
GLGD
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atgacagtcgcccccgagcgcgtcacaacgatcagccccgatgtcgtcaatcccgcggtt
tccctgtcgtgtcgccactgtggtgccgcctatccgctctccccgacgcatgtctgtatc
gagtgtttcgccccgctggagattgcctacgacgactccgcgctgcgccgggtcacccgg
gagtccatcgaagccggccccaccagcctgtggcgctatgtcgggttgttgcccgccggt
cacgaccccgcacgcagggtgtccctcggggcgggctggacgccgctgcgcccggccacc
cgcctcgccgccgagctcggaatgcggacactgtgggtcaaggacgacaccgcgaacccc
acccactcgttcaaggacagggtcgtgtcggtggcgctgtcggccgcgcgcgagcacggg
tacaccacggtcgcctgcgcgtccaccggcaacctggcccagtcggtggcggcgcacgcc
gcgtccgccgggctgcgctcggttgtgctgatcccgcacgatctcgaggacggcaagacc
gtgtcgaccgccgtctacggcggcacgctggtcgcgatcgagggcaactacgacgacgtc
aaccgcctgtgcagtgagctctccggtgagtacgagtgggcgttcgtcaacgtcaacgtg
cggccgttctacgctgagggctccaagacgctcggctacgaggtcgccgaacagctcggc
tggcggctgccggagcaggtcgtggtgccgatcgcgtccgggtcgctattgacgaagatc
gacaaggcgttcggtgagctcggccggctcggtctggtggagccgaccccgtaccgggtc
ttcggcgcgcaggcccagggctgcaacccggtcgcggcggccttcgcccgcggggtggac
acggtcgcgccggtgaagccgtccaccatcgccaagtcgctgtcgatcggcaaccccgcg
gacggcccgtacgcccttgacgtggcccgtcgcaccggcggcgcgatcaccgacgtcacc
gactccgagatcgtcgagggaatccgcctgctggcccggaccgagggcgtcttcggcgag
accgcgggcggcgtcaccgtcgcctgcctgcggcggctgctgcgcgagggcctgctcgac
cccgacgccgagaccgtcatcttcaacaccggcgacggcctgaagaccctcgacccactg
atcccgacaggccggccgaccgcgaccatccgcccctccctgagcgccttcgaagccgcc
ggcctcggcgactga

DBGET integrated database retrieval system