KEGG   Frankia symbiont: FsymDg_4472Help
Entry
FsymDg_4472       CDS       T01530                                 

Definition
dihydrolipoyllysine-residue acetyltransferase (EC:2.3.1.12)
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
fsy  Frankia symbiont
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:fsy00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    FsymDg_4472
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    FsymDg_4472
   00020 Citrate cycle (TCA cycle)
    FsymDg_4472
   00620 Pyruvate metabolism
    FsymDg_4472
Enzymes [BR:fsy01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     FsymDg_4472
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
5226275..5227879
Genome map
AA seq 534 aa AA seqDB search
MSRAQFRLPDLGEGLPDAEIVRWLVEVGEHVAVNQPIAEVETAKALVEVPSPFTGVLAVR
HAEPGDTVEVGQPLVTIDTGAGGETGGGTKTVDAATDSAESSANSIHRAAGADATAGGAS
PVTAGPGAAKGRRRGQAPAASGPDPAAGHPPGPAASGSDERGDERMPVLVGYGPRGASGV
SRRASRRSARQDPADRRQDPAGRTDGAASTAVAGWPATRGSAQPAGRPGSPRPVDSSAGP
RRSAQAVAVLAKPPVRKLARDLGVDLGTVVGTGPHGTISRADVEAARTFANGHDTDQDRV
RRIPVTGVRRATAQAMVSSVANAPQATEFVSVDVTETMAARDRLAALPEFADVRVTPLLF
VAKALLTAVGRQPMINSRWEDAVGDEPARIAVHGYVNLGIAVASPRGLVVPNIADADRMS
LVELAHALHELTVTARGGKSTPEALRGGTITITNVGVFGVDIGTPILNPPEAAILALGAI
RPMPWVHEGELAVRTVAQLALTFDHRIVDGELGSRVLADVARMLTDPTVALAWN
NT seq 1605 nt NT seq  +upstreamnt  +downstreamnt
gtgtcacgtgcgcagttccggctccccgacctgggtgagggcctgcccgacgccgagatc
gtccgatggctggtggaggtgggtgagcacgtcgctgtcaaccagccgatcgccgaggtg
gagaccgccaaggcgctggtggaggtgccctccccgttcacgggcgtgctggctgtccgg
cacgccgagccgggcgacacggtcgaggtggggcagccactggtgaccatcgacaccggc
gccggcggcgaaaccggcggcggaaccaaaactgtggacgccgccaccgacagcgccgaa
tccagcgccaacagcattcacagggcggctggcgcggacgccacggcaggcggcgccagc
cccgtcacggccggtccgggtgccgcgaagggccggcggcgcggtcaggcgcctgccgcg
tccggcccggatcccgcagccggccacccgcctggtccggccgcgtccggttcggacgag
cggggcgacgagcggatgcccgtgctggtcgggtacggcccgcgcggggcgtccggggtg
tcccggcgggcctcgcgccgaagcgcgcgccaggacccggcagacaggcgccaggacccg
gcaggcaggacggacggggcagcctcgacagcggtggccggctggcccgcgacgcgcggg
tcggcgcagcccgctggtcgacccggcagcccgcggccggtcgacagttccgccgggccg
cggcggtcggcccaggccgtcgccgtgctcgcgaaaccaccggtgcgcaagctcgcccgc
gacctcggtgtcgacctgggcacggtcgtcggcaccgggccgcacgggacgatcagccgc
gccgacgtcgaggcggcccggacgttcgcgaacggccacgacaccgaccaggaccgggtc
cgccgtatcccggtgacgggcgtccggcgggcgaccgcgcaggcgatggtgtccagcgtg
gcgaacgcgccgcaggccaccgagttcgtgagcgtggacgtcaccgagacgatggcggcc
cgcgaccggctggccgcgctgcccgagttcgccgacgtcagggtgaccccgctgctgttc
gtcgccaaggcgctgctgacggccgtcggccgccaaccaatgatcaattcccgttgggag
gacgcggtcggcgacgaacccgcgcggatcgccgtccacgggtacgtcaacctcgggatc
gcggtggcctcgccgcgcgggctcgtcgtaccgaacatcgcggacgcggaccggatgagc
ctcgtcgagctcgcgcacgcgctgcacgagctgaccgtcaccgcccgcggcggaaagagc
acaccggaggcgctacgcggcgggacgatcacgatcaccaacgtcggggtgttcggcgtc
gacatcggaacccccatcctcaacccgccggaggcggcgatcctcgcgctgggggcgatc
cgtccgatgccctgggtgcacgagggcgaactggccgtccggacggtggcgcagctcgcc
ctcaccttcgaccaccggatcgtcgacggcgaacttggctccagggtgcttgcggacgtc
gcccggatgctcaccgacccgaccgtggccctcgcctggaactga

DBGET integrated database retrieval system