KEGG   Francisella tularensis subsp. holarctica FTNF002-00: FTA_0107Help
Entry
FTA_0107          CDS       T00584                                 

Gene name
trpB
Definition
(GenBank) tryptophan synthase, beta subunit
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
fta  Francisella tularensis subsp. holarctica FTNF002-00
Pathway
fta00260  Glycine, serine and threonine metabolism
fta00400  Phenylalanine, tyrosine and tryptophan biosynthesis
fta01100  Metabolic pathways
fta01110  Biosynthesis of secondary metabolites
fta01130  Biosynthesis of antibiotics
fta01230  Biosynthesis of amino acids
Module
fta_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:fta00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    FTA_0107 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    FTA_0107 (trpB)
Enzymes [BR:fta01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     FTA_0107 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: ABU60585
UniProt: A7N9D2
Structure
PDB: 

Jmol
Position
complement(93815..95005)
Genome map
AA seq 396 aa AA seqDB search
MSKLNAYFGEYGGQFVPQILVPALDQLEQEFIKAQADESFKQEFKELLQEYAGRPTALTK
TRNIVKNTRTKLYLKREDLLHGGAHKTNQVLGQALLVKRMGKKEIIAETGAGQHGVATAL
ACALLDLKCRVYMGAKDVERQSPNVFRMKLMGAEVIPVHSGSATLKDACNEALRDWSANY
SKAHYLLGTAAGPHPFPTIVREFQRMIGEETKQQMLAKEGRLPDAVIACVGGGSNAIGMF
ADFIDEKNVKLIGVEPAGKGIETGEHGAPLKHGKTGIFFGMKAPLMQNSDGQIEESYSIS
AGLDFPSVGPQHAHLLAIGRAKYASATDDEALDAFKLLCKKEGIIPALESSHALAHALKL
AYEDPNKEQLLVVNLSGRGDKDIFTVHDILKEKGEI
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaaactaaatgcttattttggtgagtatggtggtcaatttgtaccacaaatactt
gtcccagctcttgatcaactcgagcaagaatttataaaagcacaagctgatgaatctttt
aagcaagaatttaaagagcttttgcaagagtatgcgggtcgccctactgctcttacaaaa
actagaaatatagtcaaaaacacaagaaccaagctctacctaaaacgcgaggatctacta
catggcggcgctcataaaaccaaccaagtacttggtcaagctctactagtcaagagaatg
ggtaaaaaagagataattgcagaaactggagctgggcaacatggtgttgctactgctttg
gcttgcgcactacttgatctaaaatgtagagtatatatgggtgctaaggatgttgaacgc
caaagccctaatgtctttagaatgaaattaatgggtgctgaagtcatacctgtacatagt
ggctcagctactcttaaagatgcttgtaacgaagcactaagagattggtcagcaaactat
agtaaggctcattacctactaggtactgccgctggacctcatccttttccgacgatagtt
agggaatttcaaagaatgattggtgaagaaaccaaacaacaaatgcttgctaaagaaggt
agactacctgatgctgtgattgcttgtgttggaggtggctcaaatgctattggtatgttt
gctgactttattgatgaaaaaaatgtcaagcttataggtgtagaacctgctggtaaaggt
atcgaaactggtgagcatggagctccgcttaaacatggtaaaactggtatattttttggt
atgaaggcaccactaatgcaaaactcagacggacaaattgaagagtcatactctatatca
gctggtctggattttccatctgttggacctcaacacgctcatttattagcaataggtcgt
gctaaatatgcatctgctacagatgatgaagcgttagatgcttttaaattactctgtaaa
aaagaaggaattatcccagctctagaatcatctcacgccctagcacacgctcttaaactt
gcttatgaggatcctaataaagagcaacttttggttgttaatctatctgggcgtggtgat
aaggatatttttacagtgcatgatattttaaaagaaaagggagagatttaa

DBGET integrated database retrieval system