KEGG   Francisella tularensis subsp. holarctica FTNF002-00: FTA_0225Help
Entry
FTA_0225          CDS       T00584                                 

Definition
DNA polymerase III subunit chi
Orthology
K02339  
DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
fta  Francisella tularensis subsp. holarctica FTNF002-00
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Module
DNA polymerase III complex, bacteria
Brite
KEGG Orthology (KO) [BR:fta00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    FTA_0225
   00240 Pyrimidine metabolism
    FTA_0225
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    FTA_0225
   03430 Mismatch repair
    FTA_0225
   03440 Homologous recombination
    FTA_0225
Enzymes [BR:fta01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     FTA_0225
DNA replication proteins [BR:fta03032]
 Prokaryotic Type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     FTA_0225
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
208165..208602
Genome map
AA seq 145 aa AA seqDB search
MKIEFKVLQTQDINQMLEVLITEVVKEYALQKIIAILAPAGIAKQLDDKLWQDGQDSFIP
HHCAINAREYNQYNNIPILITDNLFITSGYDVLINIMDVAVDPQRVKVKELKEFVYQQDS
ALQASRKKYVYYKKSNLEIITVQDN
NT seq 438 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatagagtttaaggttttgcagacacaagatattaatcaaatgctagaagtgctg
attactgaagttgtcaaagaatatgctttacaaaagataattgcaatcttagcaccagca
ggtattgcaaaacaactagatgataaactatggcaagatggtcaagattcttttatccca
catcattgtgctataaatgctagagagtataatcaatataataatattccaattcttatc
acagataatctatttattacctcaggttatgatgttttaataaatattatggatgtggct
gtagacccacagcgagttaaagtcaaagagctaaaagagtttgtctatcaacaagatagc
gctttacaggcttcacgtaagaagtatgtttactacaaaaaatcaaatctagagataatt
actgttcaagataactaa

DBGET integrated database retrieval system