KEGG   Francisella tularensis subsp. holarctica FTNF002-00: FTA_0329Help
Entry
FTA_0329          CDS       T00584                                 

Gene name
aceF
Definition
(GenBank) dihydrolipoamide acetyltransferase component / pyruvate dehydrogenase complex E2 component
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
fta  Francisella tularensis subsp. holarctica FTNF002-00
Pathway
fta00010  Glycolysis / Gluconeogenesis
fta00020  Citrate cycle (TCA cycle)
fta00620  Pyruvate metabolism
fta01100  Metabolic pathways
fta01110  Biosynthesis of secondary metabolites
fta01120  Microbial metabolism in diverse environments
fta01130  Biosynthesis of antibiotics
fta01200  Carbon metabolism
Module
fta_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:fta00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    FTA_0329 (aceF)
   00020 Citrate cycle (TCA cycle)
    FTA_0329 (aceF)
   00620 Pyruvate metabolism
    FTA_0329 (aceF)
Enzymes [BR:fta01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     FTA_0329 (aceF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding GCV_H Biotin_lipoyl_2 RnfC_N NQRA PTS_EIIA_1 HlyD_3 HlyD_D23
Motif
Other DBs
NCBI-ProteinID: ABU60806
Position
297893..299488
Genome map
AA seq 531 aa AA seqDB search
MSIEIVKVPDIGDYDNVDVIEVNVAVGDVIAEEDSLITLETDKASMEVPSPFAGKITKLT
VKVGDKVSQGTAIMEVEVESAADQAATTQSQPQTTSSAPVAATTNQIVDVEVPDIGDYDS
VDVIEVSVKVGDEIAEEDSLITLETDKASMEVPSPVAGKVVEVITKVGDKVSQGSLILKV
KTQGSAPVEQTSSQPAPAKQEQAKQQAATPAAPTPASSSVNEYAVDNSNAHASPAVRKLA
RILNIDLSKVKATGRKGRVTKEDCYNYIKHAVTQVQTGKVAASGSGLDLLDDPVVDFAKF
GEIETQPLSRINKISAKNLHRNWVKIPHVTFYDDADVTDLEEFRNAKKAFAEKKGIKITP
LSFLVKAAAVALQEFPRFNSSLSNDGENLIIKKYYNIGFAADTPAGLMVPVVKDADKKGI
IEISKDIMELADKARDGKLGAKDMTGATFTISSLGVLGTTSFTPIINMPEVAIMGVSKTA
VKPIWNGKEFIPRTMLPLSLSTDHRVIDGALAAKFLTRYCQILSDLREIIM
NT seq 1596 nt NT seq  +upstreamnt  +downstreamnt
atgtctatagagatagttaaagtccctgatattggggattatgataacgttgatgtgatc
gaggttaatgttgctgtaggtgatgttattgctgaagaagattcactaattacgttagaa
acagataaagcaagtatggaggttccatctccatttgcaggtaagatcactaaattaact
gtaaaagttggtgataaagtttctcagggaactgcaataatggaagttgaggttgagagt
gctgctgatcaagctgctactacacaatcacaacctcaaacaactagttcagctcctgta
gctgctacgacgaaccagattgttgatgtcgaggttccagatattggcgactatgatagt
gttgatgtgattgaggtgtctgtaaaagtaggtgatgagatagcagaagaggattcgcta
attacgcttgaaacagataaggctagtatggaagtaccatcgcctgtagcgggtaaggtt
gttgaagttattactaaggttggtgacaaggtttcgcaaggtagtttaattcttaaggtc
aaaacacaaggttcagcaccggtagagcaaactagttcacaaccagcgccagctaaacaa
gagcaagctaaacagcaagctgctacacctgctgctccaacgccagcatcaagttcggta
aatgagtatgctgtagataattctaatgcacatgcgtctcctgcagtgagaaagctagca
cgaattctaaatattgatctaagtaaggttaaagctacagggcgtaaaggtcgtgtaaca
aaagaagattgttataactatattaagcatgctgtcacacaagttcaaactggtaaggtc
gctgctagtggtagtggtttagatcttttagatgatcctgttgttgattttgctaagttt
ggtgagattgaaactcaaccattatcaagaattaacaagattagtgctaagaatttacat
cgtaactgggtgaagattcctcatgttacattctatgatgatgcggatgtcacagactta
gaagagttcagaaatgctaagaaagcctttgctgagaaaaaaggtattaagattacacct
ttatcattcttggttaaagctgctgcagttgcattacaagagttcccaagatttaatagc
tcattatcaaatgatggtgagaacttaattatcaagaaatattataatattggttttgct
gcagatactccagctggtttaatggttccagttgtcaaagatgctgataaaaagggtatc
attgaaatatcaaaagatattatggagttagctgacaaagctcgtgatggtaaacttggt
gcaaaggatatgacaggtgctacatttactatctcaagcttaggcgtgttaggtactacg
tcatttacgcctattataaatatgccagaggtggctattatgggtgtatctaagacagca
gtgaagcctatttggaatggtaaagagtttattcctagaactatgctaccattatcatta
tctacagatcatagagtgatagatggcgcattagcagctaaattcttaactagatattgt
cagattttatctgatttacgtgaaatcataatgtaa

DBGET integrated database retrieval system