KEGG   Francisella tularensis subsp. holarctica FTNF002-00: FTA_0426Help
Entry
FTA_0426          CDS       T00584                                 

Gene name
glk
Definition
glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
fta  Francisella tularensis subsp. holarctica FTNF002-00
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:fta00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    FTA_0426 (glk)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    FTA_0426 (glk)
   00052 Galactose metabolism
    FTA_0426 (glk)
   00500 Starch and sucrose metabolism
    FTA_0426 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    FTA_0426 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    FTA_0426 (glk)
   00524 Butirosin and neomycin biosynthesis
    FTA_0426 (glk)
Enzymes [BR:fta01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     FTA_0426 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(372786..373802)
Genome map
AA seq 338 aa AA seqDB search
MYILSGDIGGTNTRLEVSLLENGATQSIAIRKYKGANFNCLSDIIDKFLSEVDLVGQIDS
VCLAVAGFVSNGEVEVTNLPWMVSEQYISEGLGIDKTKVKVINDFEAIGYGIESLDREKD
IITIQEGKKDDDNLCAVVGAGTGLGMCLVSYDKDDKPRVYKTEGGHVDFSPVDDEQVELF
KFMRKTFHRISPERFCSGYGIYNIYKYVVRHPLYDQPECMELRRALFSVSDSDKAAVIVK
YAIEHREPSALRTIDIFLSIYGSVAGNLALTSLPFRGLYIAGGIAPRLIKQIKESKFLEK
FRDKGRMSNMMKDFPVHIIMNTDVGLIGARTYAAGLVK
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgtatatattatcaggagatattggtggcactaacactagattagaggtttctctttta
gagaatggtgcgacacaaagtatagctataagaaagtataaaggtgcgaatttcaattgt
ttatctgatatcattgataagtttttatctgaggtggacttagtaggtcaaatagattct
gtttgtcttgcagtagctggatttgtctctaatggtgaagttgaagtgactaatctgcca
tggatggtttctgagcaatatatctcagaaggacttggtatagacaaaactaaggttaaa
gtgattaatgactttgaagcaattggttatggtatagaatctctagatagagaaaaagat
ataatcacaatccaagaaggtaaaaaagatgatgataacttatgtgctgtagttggtgct
ggtacaggtttgggaatgtgtttagttagctatgataaagacgataagccaagagtttat
aaaacagaaggaggtcatgtggatttctcacctgttgatgacgaacaagttgagttattt
aagtttatgcgtaagactttccatcgtatctctcctgagagattctgtagcggctacggc
atttacaatatttataagtatgtggtgcgtcatcctttatatgatcaacctgaatgtatg
gagttacgtagagcgttatttagtgtttcagactctgataaggcagcagtaattgttaag
tatgctattgagcatagagaaccatcagcattaaggacgatagatatattcttaagtata
tatggctcagttgctggtaatttagcacttacaagtttaccttttagaggtctttatatt
gctggaggtattgcacctaggctcatcaagcaaataaaggagagtaaattcttagagaag
tttagagataaaggtagaatgtcaaacatgatgaaagattttccagtgcatataattatg
aacacagatgtcggtttaataggcgcgcgtacgtatgctgctgggctagtaaagtaa

DBGET integrated database retrieval system