KEGG   Francisella tularensis subsp. holarctica FTNF002-00: FTA_0576Help
Entry
FTA_0576          CDS       T00584                                 

Definition
glycosyl hydrolase family protein
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
fta  Francisella tularensis subsp. holarctica FTNF002-00
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:fta00520]
Human Diseases; Drug resistance; beta-Lactam resistance [PATH:fta00312]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
527526..528569
Genome map
AA seq 347 aa AA seqDB search
MLIVGFFGQAIDEKSEIVQHIKDNNIGGVILFDRKDKDNIKSPEQLKTLNSDLQKYTKIY
NDLYMRPQVPLIIAIDYEGGKVNRLKTKYGFPETFTAKKFSELDIQEQAHVAREMAKTMY
KVGINLNLAPCVDIHNDNCPVIGKYERSFSTDVNTIVDCANLFCKATEKYKIGSVLKHFP
GHGSSTNDSHLGDADITNTWTEKELIPYIRLLPENKHCMVMTAHVMNRNIDETNPATLSN
KIIKILRTDIKFDGVIISDAMEMKAVTEYYGELESLKLAINAGVNIFIFSDGNPDTIIDN
IAKLVESGEVAEATIKQSYENIVTYKQNYLTEETISNNISKCCCNYL
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgttgattgtaggtttcttcggtcaagcaattgacgaaaaatcggaaattgttcaacat
attaaagataataatatcggtggtgtaatattgtttgatagaaaagacaaggacaacata
aaaagtccagaacagttaaagactttaaatagcgacttacagaaatatactaagatttat
aatgatttatatatgcgtccacaggtaccattaataattgctattgactatgaaggcggt
aaagtaaatcgattgaaaacaaaatatggatttcctgaaacttttactgcaaaaaaattt
tcagagctagatatacaagaacaagctcatgttgctagggaaatggctaaaaccatgtat
aaggtaggaattaatttaaatttagccccttgtgtagacattcacaacgataattgcccc
gttattggtaaatatgagcgtagtttttctactgatgttaatactattgtagattgtgct
aatcttttttgtaaagctactgaaaaatataaaataggttctgtattaaaacacttccct
ggacatggcagctctactaatgactctcatttaggtgatgctgatattactaacacatgg
acagaaaaagaacttattccatatataaggttattaccagaaaataagcattgtatggtt
atgactgcacatgttatgaacagaaacatcgatgaaactaatccagcaacactgtctaat
aaaataattaaaatattaagaacagatattaaattcgatggagttataatctcagatgct
atggaaatgaaggctgtgacagaatattatggagaattagagtcattgaaactagctatt
aatgcgggtgttaatatatttatattcagtgacggtaatccagatactataatagataat
atcgcaaaacttgtagaatccggagaggttgcagaagcaacgataaaacaatcatatgag
aatattgtgacctataagcagaactatttgacagaagaaacaatatcaaataacattagt
aagtgttgttgtaactatttatga

DBGET integrated database retrieval system