KEGG   Francisella tularensis subsp. holarctica FTNF002-00: FTA_0576Help
Entry
FTA_0576          CDS       T00584                                 

Definition
glycosyl hydrolase family protein
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
fta  Francisella tularensis subsp. holarctica FTNF002-00
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:fta00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    FTA_0576
 Human Diseases
  Drug resistance
   01501 beta-Lactam resistance
    FTA_0576
Enzymes [BR:fta01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     FTA_0576
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
527526..528569
Genome map
AA seq 347 aa AA seqDB search
MLIVGFFGQAIDEKSEIVQHIKDNNIGGVILFDRKDKDNIKSPEQLKTLNSDLQKYTKIY
NDLYMRPQVPLIIAIDYEGGKVNRLKTKYGFPETFTAKKFSELDIQEQAHVAREMAKTMY
KVGINLNLAPCVDIHNDNCPVIGKYERSFSTDVNTIVDCANLFCKATEKYKIGSVLKHFP
GHGSSTNDSHLGDADITNTWTEKELIPYIRLLPENKHCMVMTAHVMNRNIDETNPATLSN
KIIKILRTDIKFDGVIISDAMEMKAVTEYYGELESLKLAINAGVNIFIFSDGNPDTIIDN
IAKLVESGEVAEATIKQSYENIVTYKQNYLTEETISNNISKCCCNYL
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgttgattgtaggtttcttcggtcaagcaattgacgaaaaatcggaaattgttcaacat
attaaagataataatatcggtggtgtaatattgtttgatagaaaagacaaggacaacata
aaaagtccagaacagttaaagactttaaatagcgacttacagaaatatactaagatttat
aatgatttatatatgcgtccacaggtaccattaataattgctattgactatgaaggcggt
aaagtaaatcgattgaaaacaaaatatggatttcctgaaacttttactgcaaaaaaattt
tcagagctagatatacaagaacaagctcatgttgctagggaaatggctaaaaccatgtat
aaggtaggaattaatttaaatttagccccttgtgtagacattcacaacgataattgcccc
gttattggtaaatatgagcgtagtttttctactgatgttaatactattgtagattgtgct
aatcttttttgtaaagctactgaaaaatataaaataggttctgtattaaaacacttccct
ggacatggcagctctactaatgactctcatttaggtgatgctgatattactaacacatgg
acagaaaaagaacttattccatatataaggttattaccagaaaataagcattgtatggtt
atgactgcacatgttatgaacagaaacatcgatgaaactaatccagcaacactgtctaat
aaaataattaaaatattaagaacagatattaaattcgatggagttataatctcagatgct
atggaaatgaaggctgtgacagaatattatggagaattagagtcattgaaactagctatt
aatgcgggtgttaatatatttatattcagtgacggtaatccagatactataatagataat
atcgcaaaacttgtagaatccggagaggttgcagaagcaacgataaaacaatcatatgag
aatattgtgacctataagcagaactatttgacagaagaaacaatatcaaataacattagt
aagtgttgttgtaactatttatga

DBGET integrated database retrieval system