KEGG   Francisella tularensis subsp. holarctica FTNF002-00: FTA_0690Help
Entry
FTA_0690          CDS       T00584                                 

Definition
putative uroporphyrinogen III synthase
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
fta  Francisella tularensis subsp. holarctica FTNF002-00
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:fta00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    FTA_0690
Enzymes [BR:fta01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     FTA_0690
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
639116..639865
Genome map
AA seq 249 aa AA seqDB search
MKILVCRPHNDAVNLTEKLCANGLLAVSLPTIKICYQKITESVLDYTSLVFTSKYAVESL
FSQYPIDLFKNKKIYSVGASTAAILEKYQLAAIYPVRHGSQELLDIILNQDISKEKFAII
SGVSGNDLLLEELSKLTHCHKFETYLRVFIDLYELLDTYNKLFLHNQPDIIIATSLDVFK
SLNRIFEKITTPKAATITITSLKMLKFVNQQGFKNTLKLEKLDNSYICQRILEFTEAKDV
NRKKHPATK
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatactagtttgtcgccctcataatgatgctgtcaatttaacagaaaaactctgt
gcaaatggtcttttagcggtaagtttaccaactatcaaaatttgttatcaaaaaattact
gagagtgttcttgactatacaagtctagtttttactagtaaatatgctgttgaaagcttg
tttagtcaatatccaatcgatttgtttaaaaataaaaagatctatagtgtcggtgccagt
actgctgctatattagaaaaataccaattagctgcaatatatccagttagacatggctca
caagaacttttagatatcatattaaatcaagatatttctaaagaaaaatttgcgattatt
tctggtgtctctggtaatgatcttttgcttgaagagttatcaaaattaacacactgtcat
aaatttgagacgtatttacgagtttttatagatctttatgagttgttagatacttataat
aaactttttttacataatcagccggatattataattgctacaagtcttgatgtttttaaa
tcattaaatagaattttcgaaaaaataactactccaaaggctgcaacaattaccataaca
agcctaaaaatgctaaaatttgttaatcaacaaggctttaaaaataccttaaaacttgag
aaactagataatagttatatctgtcaaagaatactagaatttacagaggcaaaagatgtc
aatagaaaaaaacacccagcaacaaagtag

DBGET integrated database retrieval system