KEGG   Francisella tularensis subsp. holarctica FTNF002-00: FTA_0705Help
Entry
FTA_0705          CDS       T00584                                 

Gene name
recD
Definition
exodeoxyribonuclease V subunit alpha (EC:3.1.11.5)
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
fta  Francisella tularensis subsp. holarctica FTNF002-00
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:fta00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    FTA_0705 (recD)
Enzymes [BR:fta01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     FTA_0705 (recD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
659160..661001
Genome map
AA seq 613 aa AA seqDB search
MYKTFHKACEQLADIRAIDFFFAKEVFDLVKKTTPSMTTLSSESYPPFHGAKGNDLEQKS
NEILFHILMKLMHVYSHGHSCLKIADISNKTIFASEQSNQSDAKVGFKMPSSDKIASILD
NLNYDNLPIYFAKQYDSLYIKRLWNYENEIANFIKLKTIQNTQKDNRIEEVVDKLFEPAG
EINWQKQAVIKSLNYNFSIISGGPGTGKTTTVAKLLLAIQMLNQNQQRIALLAPTGKAAQ
RMTESLKNTLATVIPSSLTTESTIQKNDIFKQVQDELNSVAQYLNNLEAQTIHRFLGLRP
NSTYVKYNQQSKAPFDVIIVDEASMLDMNIFIKLIRAVADNTKLILIGDTNQLPSVEAGS
LLANFTHDKYGSITPYTTLLIKNYRSQQYINNLAASVLKGDVNIDSQQNENIKFHSLRNL
DIYLREYAKRYSQLEKCRDYKEALTELNKFRILVANKNLEIGTDKLNQKIEKFMSKPIDS
NYKGKPIMITQNSYSLGLFNGDVGIMWPDDTGKLRAYFDGKDAKAFSLNMLPKYESVYAM
TIHKTQGSEFDEIVIILPAEDNEALSKQLLYTAITRAKYKLTIISEQSSLRDIAQKDINR
NSNISELVSLSTQ
NT seq 1842 nt NT seq  +upstreamnt  +downstreamnt
atgtataaaactttccataaagcttgtgagcaattagcagatattagagccatagatttt
ttctttgctaaagaggtgtttgatttagtcaaaaagactactccgtctatgaccacttta
tcaagtgagtcatatccaccctttcacggagcaaaggggaatgatttggaacaaaaaagt
aatgaaattttatttcatattttgatgaagcttatgcatgtgtatagtcatggtcatagc
tgtttgaagatagcagatatatcaaataaaactatttttgcttcagagcaaagtaatcag
agtgatgctaaagtaggctttaaaatgccaagctctgataaaattgcaagtattttagat
aacttaaattacgataatttacctatatattttgccaaacagtatgattctttgtatatt
aaaagattgtggaattatgagaatgaaatagctaactttataaaattaaaaacaatccaa
aatactcaaaaagacaatcgtattgaagaagttgtagacaaactatttgaacctgctggt
gaaatcaactggcaaaaacaggcggttatcaaaagtctaaattataattttagtattatc
tcaggtggacctggtacaggtaagacaactacagtcgcaaagcttttacttgctatacaa
atgcttaatcaaaatcagcaaagaatagcgcttttagcaccaactggtaaggctgctcag
agaatgacagagtcattaaaaaatactctagcaactgtcattccgtcaagcttgaccaca
gaatctactatacaaaaaaatgatatctttaaacaagttcaggatgaacttaatagtgtt
gctcagtatcttaataatctagaagcacaaactatacatagatttttaggcttaagacca
aactctacttatgttaaatataaccaacaatctaaagctccattcgatgttattattgtt
gatgaagcttcgatgcttgatatgaatatttttatcaagttaattagagctgtagcagat
aatactaagttgatattaataggtgatactaatcagttaccatctgttgaggctgggagt
cttttagcaaactttacacatgataaatatggtagcattacgccatatacaacattactt
atcaaaaactatcgttcacaacaatatataaataatcttgcagcctcagtcctaaaaggc
gatgttaatattgatagtcaacaaaatgaaaatattaaatttcatagtctaagaaattta
gatatttatttaagagagtatgcaaagagatattcacagcttgaaaagtgccgtgactac
aaagaggctcttacagagctgaataaatttagaatacttgtggctaacaaaaacctagaa
attggtacagataagttaaatcagaaaattgagaagtttatgtctaagcctatagattct
aactataagggtaaaccaattatgataactcaaaatagttattcattagggttatttaat
ggagatgtagggattatgtggcctgatgatactggtaagctccgagcatattttgatggt
aaagatgctaaggcatttagtctaaatatgctaccaaaatatgaaagtgtttatgcgatg
acaattcataaaactcaaggctcagagtttgatgaaatcgtgattattcttccagcagaa
gataatgaagcgctaagtaaacaacttttgtatacagctattactagagcaaaatataaa
ttaacgattatatctgaacaaagtagcttaagagatattgctcagaaagatattaataga
aattcaaatatcagtgaattagttagcttgagcactcaataa

DBGET integrated database retrieval system