KEGG   Francisella tularensis subsp. holarctica FTNF002-00: FTA_0982Help
Entry
FTA_0982          CDS       T00584                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
fta  Francisella tularensis subsp. holarctica FTNF002-00
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:fta00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    FTA_0982 (ruvA)
Enzymes [BR:fta01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     FTA_0982 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
905923..906573
Genome map
AA seq 216 aa AA seqDB search
MISFIKGVLIEKDPTALLIDVNGIGYEVFVPMTTFYTLGDIDSQVSLYTHFVVREDAQQL
YGFKSKVDKKVFQELIKVNGIGARTAIAILSGMDSKTLLHCIENKDYALLATVPGIGKKT
AERLVVEIYDKLLKMANEIYAQTSGTTTTSQDSQAQQAPTSVVLANSIFNESVDALLALG
YKQKDAEKMARSAMGDATTAAEVIRKALQGSIKSKG
NT seq 651 nt NT seq  +upstreamnt  +downstreamnt
atgataagttttataaaaggtgtattgatagagaaagatccaacagctttgcttattgat
gtaaatggtattggttatgaagtttttgtaccgatgacaacattttatacattaggtgat
attgatagtcaggttagcctttatacacattttgtagttcgtgaagatgctcagcaactc
tatgggtttaaatcaaaagttgataagaaagttttccaagagttaattaaagtcaatggt
ataggagctagaacagctattgctattttatctggtatggattcaaaaactctattacat
tgtattgaaaataaagattatgctttattagctacagtgccaggaattggtaaaaaaact
gctgagcgtttagttgtagaaatttatgataagttattaaaaatggctaatgagatttat
gctcagacttcaggtacaactacaactagtcaagattcacaagcacaacaggcaccaaca
tctgtagtattagcaaactcaatatttaacgaatccgttgatgcattattggcattaggc
tataagcaaaaagatgctgaaaaaatggctcgctctgctatgggtgatgcaactacagca
gcagaggtaattcgtaaagctctgcaaggatcaataaaatcaaaaggataa

DBGET integrated database retrieval system