KEGG   Francisella tularensis subsp. holarctica FTNF002-00: FTA_1338Help
Entry
FTA_1338          CDS       T00584                                 

Gene name
folK
Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase (EC:2.7.6.3)
Orthology
K13941  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase / dihydropteroate synthase [EC:2.7.6.3 2.5.1.15]
Organism
fta  Francisella tularensis subsp. holarctica FTNF002-00
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:fta00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1207520..1208785
Genome map
AA seq 421 aa AA seqDB search
MQYIIGIGTNSGFTIENIHLAITALESQQNIRIIRKASLYSSKAVLKEDAPKEWDIRFLN
TAVKISSSLKPDELLVLLKDIELKIGRDLNAPAWSPRVIDLDILAAEDLILETDKLTIPH
KELINRSFALAPLLELSKGWHHPKYVEWDLNIRLKELGEIVKLKQTLANTIRMGIVNLSN
QSFSDGNFDDNQRKLNLDELIQSGAEIIDIGAESTKPDAKPISIEEEFNKLDEFLEYFKS
QLANLIYKPLVSIDTRKLEVMQKILAKHHDIIWMINDVECNNIEQKAQLIAKYNKKYVII
HNLGITDRNQYLDKENAIDNVCDYIEQKKQILLKHGIAQQNIYFDIGFGFGKKSDTARYL
LENIIEIKRRLELKALVGHSRKPSVLGLTKDSNLATLDRATRELSRKLEKLDIDIIRVHK
I
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
gtgcaatatattataggaattggaacaaatagtggttttactatcgaaaatattcatctt
gcaataactgcactagaatcgcaacaaaatataagaatcatcagaaaagcaagcttatac
agtagtaaagctgtccttaaagaagacgctcctaaagaatgggatattagatttttaaat
acagctgtaaaaattagctcttcactaaagcctgatgaacttttagtactcttaaaagac
atagaattaaaaataggtagagacctaaatgctcctgcatggtcacctcgagtaattgat
ttagatattcttgctgctgaagatctaattttagaaacagacaaacttactattcctcat
aaagaactaattaatcgtagttttgcgttggctcctttattagaattatcaaagggttgg
catcaccctaaatatgttgaatgggatcttaatataagattaaaagaattaggtgagata
gtaaaacttaaacaaactcttgcaaatacaatacgtatgggtatagttaatctgtcaaat
caatctttttcagatggtaattttgacgataatcaacgtaaattaaaccttgatgagcta
atacaaagtggtgctgaaattattgatatcggagctgaatcgactaagcctgatgccaag
cctatatcgattgaagaagaatttaacaaattagatgaattcctagaatactttaaatca
caactggcaaatttgatttataaaccattagtcagtattgacacacgcaaactagaggta
atgcaaaaaattctcgctaagcatcatgatattatctggatgataaatgatgttgaatgt
aataatattgagcaaaaagcacagcttatagctaaatataataaaaagtatgttataatt
cataatttgggtattacagatagaaatcaatatttagataaagaaaatgctatagataat
gtttgtgattatattgagcaaaaaaaacaaattcttctaaaacatggtatagcacaacaa
aatatttattttgatattggctttggttttggtaaaaaatcagataccgctagatactta
ttagagaatatcatcgagataaaaagaagattagaattaaaagcattagttggtcactca
cgtaagccatcagttttaggattaacaaaagatagtaatttagcaactttagatcgagct
acaagagagctttcaagaaaattagagaaactagatattgatattataagagtacacaag
atttaa

DBGET integrated database retrieval system