KEGG   Francisella tularensis subsp. holarctica FTNF002-00: FTA_1338Help
Entry
FTA_1338          CDS       T00584                                 

Gene name
folK
Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase (EC:2.7.6.3)
Orthology
K13941  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase / dihydropteroate synthase [EC:2.7.6.3 2.5.1.15]
Organism
fta  Francisella tularensis subsp. holarctica FTNF002-00
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fta00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    FTA_1338 (folK)
Enzymes [BR:fta01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     FTA_1338 (folK)
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     FTA_1338 (folK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1207520..1208785
Genome map
AA seq 421 aa AA seqDB search
MQYIIGIGTNSGFTIENIHLAITALESQQNIRIIRKASLYSSKAVLKEDAPKEWDIRFLN
TAVKISSSLKPDELLVLLKDIELKIGRDLNAPAWSPRVIDLDILAAEDLILETDKLTIPH
KELINRSFALAPLLELSKGWHHPKYVEWDLNIRLKELGEIVKLKQTLANTIRMGIVNLSN
QSFSDGNFDDNQRKLNLDELIQSGAEIIDIGAESTKPDAKPISIEEEFNKLDEFLEYFKS
QLANLIYKPLVSIDTRKLEVMQKILAKHHDIIWMINDVECNNIEQKAQLIAKYNKKYVII
HNLGITDRNQYLDKENAIDNVCDYIEQKKQILLKHGIAQQNIYFDIGFGFGKKSDTARYL
LENIIEIKRRLELKALVGHSRKPSVLGLTKDSNLATLDRATRELSRKLEKLDIDIIRVHK
I
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
gtgcaatatattataggaattggaacaaatagtggttttactatcgaaaatattcatctt
gcaataactgcactagaatcgcaacaaaatataagaatcatcagaaaagcaagcttatac
agtagtaaagctgtccttaaagaagacgctcctaaagaatgggatattagatttttaaat
acagctgtaaaaattagctcttcactaaagcctgatgaacttttagtactcttaaaagac
atagaattaaaaataggtagagacctaaatgctcctgcatggtcacctcgagtaattgat
ttagatattcttgctgctgaagatctaattttagaaacagacaaacttactattcctcat
aaagaactaattaatcgtagttttgcgttggctcctttattagaattatcaaagggttgg
catcaccctaaatatgttgaatgggatcttaatataagattaaaagaattaggtgagata
gtaaaacttaaacaaactcttgcaaatacaatacgtatgggtatagttaatctgtcaaat
caatctttttcagatggtaattttgacgataatcaacgtaaattaaaccttgatgagcta
atacaaagtggtgctgaaattattgatatcggagctgaatcgactaagcctgatgccaag
cctatatcgattgaagaagaatttaacaaattagatgaattcctagaatactttaaatca
caactggcaaatttgatttataaaccattagtcagtattgacacacgcaaactagaggta
atgcaaaaaattctcgctaagcatcatgatattatctggatgataaatgatgttgaatgt
aataatattgagcaaaaagcacagcttatagctaaatataataaaaagtatgttataatt
cataatttgggtattacagatagaaatcaatatttagataaagaaaatgctatagataat
gtttgtgattatattgagcaaaaaaaacaaattcttctaaaacatggtatagcacaacaa
aatatttattttgatattggctttggttttggtaaaaaatcagataccgctagatactta
ttagagaatatcatcgagataaaaagaagattagaattaaaagcattagttggtcactca
cgtaagccatcagttttaggattaacaaaagatagtaatttagcaactttagatcgagct
acaagagagctttcaagaaaattagagaaactagatattgatattataagagtacacaag
atttaa

DBGET integrated database retrieval system