KEGG   Francisella tularensis subsp. holarctica FTNF002-00: FTA_1435Help
Entry
FTA_1435          CDS       T00584                                 

Gene name
galU
Definition
UTP--glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
fta  Francisella tularensis subsp. holarctica FTNF002-00
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:fta00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    FTA_1435 (galU)
   00052 Galactose metabolism
    FTA_1435 (galU)
   00500 Starch and sucrose metabolism
    FTA_1435 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    FTA_1435 (galU)
Enzymes [BR:fta01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     FTA_1435 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1289934..1290797)
Genome map
AA seq 287 aa AA seqDB search
MKIRKAVFPVAGWGTRFLPATKSCPKEMLTVVDKPLIQYAVEEAIEAGCKEIIFVTSSNK
KSLEDHFDRNFELEYSLEKKQKYELLDLVKNIIPKDVSFFFVRQPEALGLGHAVLCAKPL
VGIEDFAVILPDDLIYNHDCGTGTLKQMVKVVEGTDIRGCIATQQVKREKTNSYGIVAKD
NDNLIKAIVEKPAPEKAPSTNAVVGRYLLPNKIFRCLESTSEGAGGEIQLTDAIAKLLDQ
DEKILSYEFKGTRYDCGSKLGFLIANYEIALQHQELGHKFKEYLQNR
NT seq 864 nt NT seq  +upstreamnt  +downstreamnt
atgaaaataagaaaagcagtttttcctgtagctggatggggcactagatttttaccagct
actaaatcatgtcctaaagaaatgctaacagttgttgataaaccattgatccaatatgct
gttgaagaggctatagaggcaggctgtaaagagataatatttgttactagctcaaataaa
aaatccctagaagatcattttgatagaaactttgaattagaatattcgctagaaaaaaaa
caaaaatatgaattgttagatttagtaaaaaatataattcctaaagatgtaagttttttc
tttgtacgtcagccagaggcgctaggactagggcatgcggttttatgtgcaaaaccacta
gttggaattgaggattttgcagttatattacctgatgatttaatttacaatcatgattgt
ggtactggtacgctaaagcaaatggttaaggtggtagaaggtactgatattagaggttgt
atcgcaactcaacaagtcaagagagaaaaaacaaattcatatggtatagttgcaaaagat
aatgataatctaatcaaagcaattgttgaaaagccagcaccagaaaaagcaccatcaact
aatgcagttgtgggtagatatttattaccaaataagatttttagatgtttagaatcaact
tcagagggcgcaggtggtgagattcaactaactgatgctatcgctaaattattagatcag
gatgagaaaattttgtcttatgaatttaagggtactcgttatgattgtggcagtaaatta
ggttttttaattgctaattatgagatagctttacagcatcaagagttaggacataaattc
aaagaataccttcaaaatagatag

DBGET integrated database retrieval system