KEGG   Francisella tularensis subsp. holarctica FTNF002-00: FTA_1688Help
Entry
FTA_1688          CDS       T00584                                 

Gene name
hemB
Definition
delta-aminolevulinic acid dehydratase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
fta  Francisella tularensis subsp. holarctica FTNF002-00
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:fta00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    FTA_1688 (hemB)
Enzymes [BR:fta01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     FTA_1688 (hemB)
Exosome [BR:fta04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   FTA_1688 (hemB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1527228..1528202)
Genome map
AA seq 324 aa AA seqDB search
MSFPISRPRRLRVTQAFRDIVAETTLSLDDLMYPIFVVHGQGVKKEISSMPNQYHWSVDM
LDELVDQVVKAGIRSLMIFGLPKIKDLVSSENYDPNGITQQAIRKIKQLAPELVIATDVC
MCSFTPHGHCGILDEHDYVDNDQTLEILQKTAVSHAQAGADIVAPSGMMDGMIIAMRQAL
DEASFENVSIMSYSVKYASAYYGPFRSACSSSLKGDRKTYQMDYRNKKEAICEALADIEQ
GADFIMVKPALSYLDIVNELSHIIDLPIAAYHVSGEYAMIKAAASAGLVDEKAITIETLI
SMKRAGAKVILTYTALDVANWLKV
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgagctttccaatatcacgtccacgtagacttagggttacacaagcttttcgcgatatc
gttgctgagacaactttaagccttgatgacttaatgtatccaatatttgttgtgcatggt
caaggagttaaaaaagaaatttcaagtatgccaaatcaatatcattggtcagttgacatg
cttgatgagttagtagatcaagttgtcaaggctggaataaggagtctaatgatatttggc
ttgccaaaaatcaaagatcttgtttcatcggagaattatgatcctaatggaataacacag
caagcaattagaaagattaaacaacttgctcctgagcttgtgatagctacagatgtatgt
atgtgtagttttacaccacatggtcattgtggaattttagatgagcatgattatgttgat
aacgatcaaacattagaaatattacaaaaaacggctgtttctcatgctcaagctggagca
gatattgtagcaccaagtgggatgatggatggtatgataattgcgatgcgtcaggcacta
gatgaggcaagctttgagaatgtgagtattatgtcatactcagttaaatatgcatcggca
tattatggaccatttagaagtgcttgtagttcgtcacttaagggagatcgtaaaacttat
cagatggattatcgcaataagaaagaggcaatctgtgaggcgcttgcagatattgagcag
ggtgcagattttattatggttaaaccagctttgagttatctggatattgtcaatgagtta
agtcatattatagatttaccaatagcagcatatcatgtcagtggtgaatatgcgatgata
aaagctgctgctagtgctggtttagttgatgaaaaagcaatcactatagaaacactcata
tcaatgaaaagagcaggtgctaaagtgatacttacatatactgcgttggatgtggctaat
tggttaaaggtttaa

DBGET integrated database retrieval system