KEGG   Francisella tularensis subsp. holarctica FTNF002-00: FTA_1893Help
Entry
FTA_1893          CDS       T00584                                 

Definition
hypothetical protein
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
fta  Francisella tularensis subsp. holarctica FTNF002-00
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:fta00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    FTA_1893
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    FTA_1893
   00650 Butanoate metabolism
    FTA_1893
  Energy metabolism
   00190 Oxidative phosphorylation
    FTA_1893
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1716098..1716466)
Genome map
AA seq 122 aa AA seqDB search
MGVLLMAVISLTSSGIKDFFVQRVTAVIIAVYFGYLILEALYLSHIGALNYDSWRGLFTD
GMFFRVATLMVYLAMFFHAWVGIWIICGDYIKFAWAFALVMLSFVLVYIFCFFWLFAVLF
FY
NT seq 369 nt NT seq  +upstreamnt  +downstreamnt
atgggggtgttacttatggctgtaatttcattaacttcttctggaattaaagactttttc
gtacaaagagttacggctgtaattattgctgtatattttggttatcttatcctagaagct
ttgtatttgtcgcatataggagctcttaactatgatagttggagaggtttgtttaccgat
gggatgttttttagagttgctacgttaatggtgtacttggcgatgttttttcatgcatgg
gtaggtatctggattatatgtggcgattatattaaatttgcttgggcttttgcgcttgtg
atgctgagctttgttttggtgtatatattctgctttttttggttatttgcagttttattt
ttctattaa

DBGET integrated database retrieval system