KEGG   Francisella tularensis subsp. holarctica FTNF002-00: FTA_1973Help
Entry
FTA_1973          CDS       T00584                                 

Definition
protein-L-isoaspartate(D-aspartate) O-methyltransferase (EC:2.1.1.77)
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
fta  Francisella tularensis subsp. holarctica FTNF002-00
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1793071..1793691)
Genome map
AA seq 206 aa AA seqDB search
MNFELARENMVKQQVLTEGLSLDGVAKVMADIPREIFLPRELQTLAYCDTNLVVNERELR
SPMFTARLIEALAIKVSDNVLKLGLESGYPVALIAKLCKSVELVDYDELGLAVARRQLAS
IGIYNVEFNSAEHITNIIKNGKKYNCIYISEVVTEDEIDESLLGLLETGGRLIFVVRTAI
CDKAYLITKTPKQTYEKSFLFNTYNK
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atgaattttgagcttgctagagaaaatatggtaaagcaacaggttcttactgaaggactt
tctttagatggtgttgctaaagttatggcagatattcctagagagatttttttgcctaga
gagcttcaaactttagcttattgcgacacaaatttagttgtaaatgaaagagaattaaga
agtccgatgtttacagctaggcttatagaagcattagccatcaaagttagtgataatgtc
ttaaaacttggtttggaaagtggttatccggtagctttaatagccaagttatgtaaaagt
gttgagcttgttgattatgatgagttagggttagccgtagcaaggcgtcagctagcaagt
attggtatatataatgttgagtttaatagtgctgagcatataactaatattataaaaaat
ggcaaaaaatataattgtatctacatatcagaagttgttactgaggatgagattgatgag
tcgttattagggcttcttgagactggcggtagactgatatttgtcgttagaacagctata
tgtgataaagcatacttaataacaaaaactccaaagcaaacatacgaaaagagttttctc
tttaatacatacaataagtaa

DBGET integrated database retrieval system