KEGG   Fluviicola taffensis: Fluta_0260Help
Entry
Fluta_0260        CDS       T01455                                 

Definition
NAD-dependent epimerase/dehydratase
Orthology
K00091  
dihydroflavonol-4-reductase [EC:1.1.1.219]
Organism
fte  Fluviicola taffensis
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
273298..274275
Genome map
AA seq 325 aa AA seqDB search
MKVAITGGNGHIGNAIIEELLRRDYTIKALVHSKSNFLESRAVEIVKGSLLDENSLTELM
KDCDYLIHCAAIISISGDQNGLVQEINIKGLENVLRVALKSNLKRVIHLSSVHAYNHQPM
NELLNEKRNFVSDTAYHYDKSKRDGQLLAHKYFEAGLPIIVVNPTSVFGPPNYAKCKQNS
AFISMSKGKVPFVFKGGYNWVDVRDIANSICNALTQGQIGESYILGGNYYTLKDLSRVVA
KVSNKRIPCFEVPIGLVKSFLPIIGRYYKIRKQDPSLTKESIEILEFGNKQINSEKARKD
LGHNPRPIEDTMKDLLTWHSENQKS
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
gtgaaagtagcaataacaggtggtaatggacatattgggaatgccattattgaagaatta
cttcgcagagattatacaatcaaagcacttgttcattcaaaaagcaacttcttggaaagt
agagctgttgaaatcgtaaaaggttctttgttagatgagaattcactcactgaactcatg
aaagattgcgattatttgattcattgtgcagctattatttcaatttcgggggatcagaat
ggattggttcaagaaatcaacatcaaaggattagaaaatgtactccgtgttgctttaaaa
agcaatttaaaacgtgttattcacctttcttctgttcatgcatacaatcatcaaccaatg
aatgaattgttgaatgagaagcgaaattttgtttctgacacagcttatcattacgataaa
agcaaacgagatgggcaacttcttgcacataaatactttgaagcaggcttgcctattatt
gttgtaaatccaacttctgttttcggtccaccaaactatgcgaagtgcaaacaaaacagc
gcatttatctctatgtctaaaggaaaagttccattcgtattcaaaggaggatacaattgg
gtagatgtgcgagatattgcaaattcaatttgtaatgcactcactcaaggtcaaattgga
gaatcctatattcttggtggaaattattatacactgaaagatttatcacgggtagttgcc
aaagtttccaataagcgaattccttgttttgaagtccctattggattggtgaaatcattt
ctgccaataattggaagatattataaaataagaaaacaagatccttctctgaccaaagaa
agcatcgaaattttagaatttggaaataaacaaattaattctgaaaaagcaaggaaagat
ttaggtcataatccgcgaccaatagaagatacgatgaaagatttattaacttggcatagc
gagaatcaaaaatcatga

DBGET integrated database retrieval system