KEGG   Fluviicola taffensis: Fluta_0261Help
Entry
Fluta_0261        CDS       T01455                                 

Definition
3-oxo-5-alpha-steroid 4-dehydrogenase (EC:1.3.99.5)
Orthology
K12343  
3-oxo-5-alpha-steroid 4-dehydrogenase 1 [EC:1.3.1.22]
Organism
fte  Fluviicola taffensis
Brite
Enzymes [BR:fte01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.22  3-oxo-5alpha-steroid 4-dehydrogenase (NADP+)
     Fluta_0261
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
274272..275027
Genome map
AA seq 251 aa AA seqDB search
MTQEQFYYFCYVWIGVGVIAFLGLQFKDAPYGKFTTSKWGPTMSNRWGWVIMEAFVLVVL
YYFILTSSKKLSAVDWTIVSLFTAHYINRSFIYPFRTRTKGKQIPVSIVGMALFHNLANG
FLIGYYLSHFSSYTNDWFTSWQFIVGITLFVIGMFTNIYSDTVLIRLRKNPTDGYKIPFG
RPFNLISAPNLGGELLEWIGFAILCWNLPAFCFAFFTFCNLFPRALANHKWYKQTFADYP
KERKAVIPFIC
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgacacaagaacaattctattacttctgctacgtctggatcggagtgggcgttattgca
tttttagggcttcaattcaaggatgcgccttacggtaaattcaccacttccaaatggggg
ccaacgatgtctaatcgctggggatgggttattatggaagcatttgtattggttgttctt
tattatttcattcttacaagctctaaaaaactctcagctgttgattggacaatcgttagc
ttgtttactgcacattacatcaacagaagtttcatttatccattcagaacacgtacaaaa
ggcaagcaaatacctgtgagcattgtaggaatggcactattccataatttagcaaacgga
ttcctaatcggctattatctctctcatttttcttcctatacgaatgattggtttacttct
tggcaattcattgttggaattactctttttgtaattggaatgttcacgaatatctattct
gatactgttttgatcaggttaagaaaaaatcctacagatggatacaaaattcctttcgga
cgcccatttaacttgatttctgcaccaaatttaggtggtgaattattggaatggattggt
tttgcgattctgtgctggaatcttcctgctttctgctttgcgttctttactttttgtaat
ttatttccaagagcacttgcgaaccacaaatggtacaaacaaacattcgcagattatccg
aaagaaagaaaagcggtgattccttttatttgttag

DBGET integrated database retrieval system