KEGG   Fluviicola taffensis: Fluta_0686Help
Entry
Fluta_0686        CDS       T01455                                 

Definition
(GenBank) acetyl-coenzyme A synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
fte  Fluviicola taffensis
Pathway
fte00010  Glycolysis / Gluconeogenesis
fte00620  Pyruvate metabolism
fte00640  Propanoate metabolism
fte00680  Methane metabolism
fte01100  Metabolic pathways
fte01110  Biosynthesis of secondary metabolites
fte01120  Microbial metabolism in diverse environments
fte01130  Biosynthesis of antibiotics
fte01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:fte00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Fluta_0686
   00620 Pyruvate metabolism
    Fluta_0686
   00640 Propanoate metabolism
    Fluta_0686
  Energy metabolism
   00680 Methane metabolism
    Fluta_0686
Enzymes [BR:fte01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Fluta_0686
Lipid biosynthesis proteins [BR:fte01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Fluta_0686
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding ACAS_N AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: AEA42690
UniProt: F2IHD5
Position
complement(787074..788978)
Genome map
AA seq 634 aa AA seqDB search
MNNMQIKSLEEYHEKYALSVSNPEGFWEEIANEFQWMKKWDKVLEWNFTEPDIKWFKGAK
LNITENMLDRHLEKRGNKLALIWEPNDPKQRFVRYTYRELYEQVCVFSNALKAQGVKKGD
RVCIYMPMIPELSIAVMACARIGAIHSVVFAGFSANALADRIEDAQAKLIITSDGLNRGP
KQIPVKRVVDEALEKVECVEKVIVFDCLGWLPHMEEGRDIWWSDAIAGHEKKCVPEEMDA
EDPLFILYTSGSTGKPKGVVHTCGGYMVYTAYSFQNVYQYEESDVFWCTADIGWITGHSY
IVYGPLLCGATTVMFEGVPTYPDAGRFWQVIDKYGVNQFLTAPTAIRALMACGDDHVLSY
SLDSLKIIGTVGEPINEEAWKWYHLHVGKGRCPVVDNWWQTETGGIMISGIGNISPQKPT
FAGYPLPGIQPVLLNQEGKEIEGADQEGYLCIKFPWPSILRTTYGDHERCRVTYFSHYDG
YYFTGDGAKRDENGMYRIIGRIDDVINVSGHRFGTAEIENAINTNKLVIESAVVGYPHPV
KGQSIYAFVVCEHEVPVEEQEFARAEILESVVSEIGKIAVPEKIQFVTGLPKTRSGKIMR
RILRKIAEGDMTSIGDTSTLLDPLVVDEIVEKAL
NT seq 1905 nt NT seq  +upstreamnt  +downstreamnt
atgaataacatgcaaattaaatccctggaagaatatcatgaaaaatatgctttgagtgtt
tctaatccggaaggtttttgggaagagattgccaatgaatttcaatggatgaagaagtgg
gataaagttcttgaatggaactttactgagcccgatatcaaatggtttaaaggtgcaaag
ctcaatattactgaaaacatgttggatcgtcacttggaaaaacgcggaaataaattggcg
ttaatttgggaaccaaatgatccgaagcaacgtttcgtgcgttacacttatcgtgagttg
tatgaacaagtttgcgtgttctcaaatgcattgaaagcacaaggtgtaaaaaaaggagat
cgtgtttgtatctacatgccgatgattccagagttatcaatcgctgtgatggcgtgtgct
cgaattggagctattcattcggtggtttttgcagggttttctgcaaatgctttggcagat
agaattgaggatgcgcaagcaaaattgattattacttctgatggcttgaatcgtggtcca
aagcaaattccagtgaaacgagttgtggatgaggcattagaaaaagtggagtgtgtagag
aaagtaatcgtttttgattgcttgggctggttgcctcatatggaagaaggaagggatatt
tggtggtctgatgcaattgctggtcatgaaaagaaatgtgtgccagaagaaatggatgca
gaggatccgttattcattttatacacttcaggttctacgggaaaaccaaaaggcgttgtt
catacttgtggtggttatatggtttatactgcatattcctttcagaatgtgtatcaatat
gaagaaagtgatgtgttttggtgtacagcagatatcggttggataactggacattcatac
attgtttatggacctttactttgcggagcaactactgttatgtttgaaggtgtaccaact
tatccagatgcgggtcgtttttggcaagtaattgataaatatggggtgaatcagttttta
actgctccaactgcaattcgcgcattgatggcttgtggagatgatcatgttttgtcatat
agtttagattccctgaaaataatcggaacggtaggcgaaccaatcaatgaagaagcttgg
aaatggtatcatttacatgttggtaaaggtcgttgcccagtagttgataactggtggcaa
actgaaactggaggaattatgatttcaggaattggaaatatttcgcctcaaaagccgacg
tttgctggttatcctttacctggaatacaacccgttttgttgaaccaagaaggaaaagag
attgaaggtgcggatcaagaaggttatttgtgtatcaaattcccgtggccttctatctta
agaaccacttacggagatcacgagcgttgtcgggttacttacttctcgcattacgatggt
tattacttcacaggtgatggtgcaaaacgagatgaaaatggaatgtatcgaatcattgga
cgaattgatgatgtaatcaacgtttcaggtcaccgttttggaactgccgaaattgaaaat
gcaatcaacaccaataagttagtcattgaatctgcagttgtgggttatccacatcctgtg
aaaggtcaatctatttatgcttttgttgtttgtgaacacgaagtgccggtagaagaacag
gagtttgcacgcgcagaaattttagaatcagtagtttcggaaattggtaaaatagctgtc
cctgaaaagattcaattcgtaacaggattacccaaaacacgttcaggaaaaatcatgcga
cgcatcttgcgtaaaatcgctgaaggcgatatgacaagtattggagatacttccacattg
ctagatcctttggtggttgatgaaatcgtggagaaggcgttgtag

DBGET integrated database retrieval system