KEGG   Fluviicola taffensis: Fluta_1034Help
Entry
Fluta_1034        CDS       T01455                                 

Definition
GTP cyclohydrolase I (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
fte  Fluviicola taffensis
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:fte00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1159996..1160586
Genome map
AA seq 196 aa AA seqDB search
MSDFHYNDDTTENISTIYKSILSQIGENPEREGLLKTPERVAKALQFLTQGYDIKPADIL
KSALFHEEYSEMVIVKDIEVYSMCEHHMLPFFGKAHIAYIPNGTIVGLSKIPRVVDAFSR
RLQVQERLTIEIRDCIQETLKPKGVAVVLECQHMCMQMRGVQKQNSVTTSSAFTGLFLSN
DSTRKEFINLVQAKLH
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
atgagcgattttcattacaacgacgacacaacggaaaacatttcaactatttacaaatcg
attctttctcaaattggcgaaaatccagagcgtgaaggcttactaaaaactcccgaacgc
gtagcaaaagcattgcaatttttaacgcaaggatacgacattaaaccagctgacatttta
aaaagcgctttgtttcacgaagaatattcggaaatggtgattgtgaaagacattgaagtt
tattcaatgtgtgagcatcacatgcttcctttttttggaaaagcacacattgcctatatt
ccaaacggaacaatcgttggattgagcaaaattccacgagtagtggatgcttttagcaga
agattacaagttcaggagcgtttgacgattgaaattcgcgattgcatccaagaaacattg
aaaccaaaaggtgttgcagttgttttggaatgtcagcacatgtgtatgcaaatgcgcggc
gtacagaaacaaaattcggtaacgacttccagtgcatttactggcttatttttaagcaac
gattcaactagaaaagagtttattaatttagtacaagcaaaattgcattaa

DBGET integrated database retrieval system