KEGG   Fluviicola taffensis: Fluta_1154Help
Entry
Fluta_1154        CDS       T01455                                 

Definition
Cytochrome-c peroxidase (EC:1.11.1.5)
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
fte  Fluviicola taffensis
Brite
Enzymes [BR:fte01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     Fluta_1154
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1296817..1298715)
Genome map
AA seq 632 aa AA seqDB search
MKVFFFVLSLAAISVLLSVESGGNATTSTIEPKSRYIFEELNLLINELKDFREDIQVSTK
REAHYFKVREYYKHIEFFVEHISPIQAKYKINGALVPKFSEYEEGFVVDPCGLQKVEEFL
FSGEDFVLADLEKELVQLIEVFQELKNGYANIHLENQIYLEMLQLQLVRIASMNLNGYDA
TFTKTNLKEIEWNLVSMKQIVRSFESEIGKNKEASKALKSLLKNIQSAQKTLHKNTDFDS
FDRLDFIATNLENINLQLVQLHRALGLPWSDHKQALRLNSARLFSPETLNPQFFSIYYTD
KSDLEKQAALGKLLFYDPILSVNNQRACSSCHQPDKAFTDGLKTSQAFNNEGVLPRNAPS
LINVLYQKAYFYDGKAYQLEQQIRDVVHNEKEMGSKLADVVLKLRLSDEYKSLFKSAFKD
QKDAAISEYAISKAISEYEKTLVAMNSRFDRYLAGERTAMNPREINGYSLFAGKALCGSC
HFFPLFNGTVPPYFMDSEYEILGTPATNENKSLDPDKGRYLVTKVEKQMYAFKTPTVRNS
ELTAPYMHNGIYTDLKQVLQFYQKGGGEGLKYSVPNQTLPFDSLQLSDYEQENIILFMKS
LTDTVGLFQKPFKLPRFESKPTWNTRAWGGMY
NT seq 1899 nt NT seq  +upstreamnt  +downstreamnt
atgaaagttttctttttcgttttatctcttgctgcaataagcgttttattaagtgttgaa
agtgggggtaacgctactacttcaactattgaacccaaaagtcggtatatttttgaggag
ttgaatttgctcatcaacgaattgaaagatttccgagaggatattcaagtttctaccaaa
cgagaagcgcattatttcaaagtgcgtgaatactacaaacacatcgagttttttgtagag
cacatttctcccattcaagcaaaatataaaatcaatggagcacttgtccctaagttttcg
gaatacgaggaaggatttgtcgtggatccttgcggcttacaaaaagtggaagaattcctt
ttttcaggagaagattttgttttagccgatttggaaaaagaactggttcaattaattgaa
gtgtttcaagagttgaagaacggatatgcaaatatccacttagaaaatcagatttattta
gaaatgctacaattgcaattggtgcgcattgcttctatgaatttgaatggttatgatgcg
acttttaccaaaacaaatttgaaggagatagaatggaatctcgtttctatgaaacaaatt
gttcgcagttttgaatctgaaatcggaaaaaacaaagaagcttcaaaggctttgaaatcg
cttttaaaaaacattcaaagtgcacaaaaaacactgcacaaaaacaccgattttgattcc
tttgatcgcctagattttatagcaactaatttggagaatatcaatcttcaattggttcaa
cttcatcgtgcgttaggtttaccttggtctgatcacaaacaagctctccgcttaaattcg
gcacgacttttttctcctgaaaccttaaacccgcaatttttctctatttattacaccgat
aaatcggatttggagaagcaagctgctttggggaagttgcttttttacgatccaatcctt
tctgtcaataaccaacgagcgtgcagtagttgtcatcaacccgataaagcgttcaccgat
ggattgaaaacaagtcaggcgttcaataatgaaggcgttttgcctcggaatgcaccaagt
ttgattaatgtattgtatcaaaaagcgtatttctacgatgggaaagcgtatcaattggag
cagcaaattcgagatgtggtgcacaatgaaaaagaaatgggcagcaagctagcagatgtt
gtgctgaaattgcgcttaagtgacgaatataaaagcttgttcaagtccgcatttaaagat
caaaaagatgcagctatttctgaatatgcgatctccaaagccattagcgaatacgaaaaa
acattggtagcaatgaacagtcgttttgatcggtatttggctggagaaagaactgctatg
aatccgcgtgaaattaatgggtatagtttgtttgctggaaaagcgctctgtggttcgtgt
catttttttccactctttaatggaacagttccaccttatttcatggattctgaatacgag
attttgggaacacccgcaaccaatgaaaataaatcattggatccagacaaaggacgttat
ttagtaacaaaagttgaaaaacaaatgtatgcgtttaaaacaccaacagtaagaaatagc
gagttaacagctccatatatgcacaatggaatatatacggatttgaaacaagtactccaa
ttttatcaaaaaggcgggggggaaggattaaaatattccgttccaaatcaaacgctgcct
tttgattcattgcagttatccgattacgagcaggaaaacattattcttttcatgaaatcg
ctaacagatactgttggattatttcaaaagccttttaaattgccccgatttgagtcaaaa
cctacttggaatacgcgtgcttggggcggaatgtattga

DBGET integrated database retrieval system