KEGG   Fluviicola taffensis: Fluta_1210Help
Entry
Fluta_1210        CDS       T01455                                 

Definition
alkaline phosphatase (EC:3.1.3.1)
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
fte  Fluviicola taffensis
Pathway
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:fte00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Fluta_1210
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    Fluta_1210
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Fluta_1210
Enzymes [BR:fte01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     Fluta_1210
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1365645..1367495)
Genome map
AA seq 616 aa AA seqDB search
MRSFISFSILLLVPFLGISQHTPKAVSPCMRPFYHGVASGDPMPDRVILWTRITPENGST
APQIVEWKIAKDTNFTLNVQNGVVITDATKDFTVKVDPTGLDPNTTYYYQFKSDTLKSVI
GRTRTTPVGDCDSLRFAVVSCANYEAGFFNVFAALKERNDIDAVICLGDYIYEYQSGGYS
PNPTANRQWSPVNETISLLDYRARYSTYRLDDDLRDMHQQFPMIVVWDDHETANDSWMNG
AENHQANEGSYAARKASAKQAFFEWLPIRVTGTTDPYQIFREIKYGDLIDLVMLDTRLHG
RDQQAGTSGSTVTATTRQLLGTDQFSWLGNRLSQSTAQWKIIGQQVMMAPLTLFGAALNG
DQWDGYPAERNRVYNHILTYGVQDVVVLTGDIHSSWANDLPGSSYSSNGNGSVGVEFVAP
SVTSPGMNIPGGASAIQLANSHIKFAELSSHGFVILDVNKVRTQADWFFVNTIDTENSGY
SYAASYKTNHTSRNLTSVNAASMPRNGIQGFQLKTCPYYPPSISNLGLDEDKPVILSLYP
NPVSNQLFLNLSLPYTGQTSFELIDGLGHLIPLRSENIQLTGSNQFAFDFSNIPAGSYIL
RINNNGSMIQSQVVKY
NT seq 1851 nt NT seq  +upstreamnt  +downstreamnt
atgagatcattcatttccttttcaattctcttgttggttccatttttaggaatttcgcaa
catactccaaaagcggtttcaccttgtatgaggccattttatcacggagttgcgtctggt
gaccccatgcctgatcgtgttattctttggactcggattacgcctgaaaatggaagtaca
gcaccacaaattgtggaatggaaaatcgccaaggatacgaattttacattaaatgttcaa
aacggtgttgtcattacagatgctacaaaagattttacggtcaaagtggatccaactggt
ttggatcccaacaccacttattattatcaatttaaatcagatacactaaaaagtgtgatc
ggtagaacacgaaccacaccagttggggattgtgatagtttgcgcttcgcagtcgtttct
tgtgccaattacgaagctggatttttcaatgtatttgcagctttgaaggaacgtaacgat
attgatgcagttatttgtttgggtgattatatttatgagtatcagtctggtggatattca
ccaaatccaacagcaaatagacaatggtcaccggtgaatgaaacgattagtttgttggat
taccgcgcacgttattcaacatatcgtttagacgatgatttgagagatatgcatcaacaa
tttccaatgattgttgtttgggatgatcatgaaactgcaaatgactcgtggatgaatggt
gcagaaaatcaccaggcaaatgaaggaagttatgccgctcgaaaagcaagtgcgaaacaa
gccttttttgaatggttacctattcgagtaacaggaacaacagatccatatcaaattttc
agagaaattaaatacggagatttgattgatttagtgatgttggatacacgtttgcatggc
agggaccaacaagcggggacttctggatctacagttacggcaactaccagacaattactc
ggaactgatcaattttcttggttaggtaataggctttcacaaagtacggcgcaatggaaa
atcattggccagcaagtaatgatggcgcctttaacgttatttggagcagcattgaacgga
gatcaatgggatggttatcctgcagagcgaaatcgggtttacaatcacattttaacttac
ggagttcaagatgttgttgtattaacaggagatattcactcttcgtgggcaaatgattta
ccaggtagttcttattcaagcaacggaaatggttctgtgggagttgaatttgtggctcca
agtgttacttctccagggatgaatattccaggaggcgcatctgcgattcagttggcaaat
agccacattaagtttgcagaattgtcgagtcatggctttgtgattttagatgtaaataaa
gtacgaacacaggctgattggttttttgtaaatacaatcgatacggagaatagtgggtat
agttatgcggcttcttacaaaacgaatcacacttctagaaatttgacaagtgtaaatgct
gctagtatgccgcgaaatggaattcagggatttcagctgaaaacatgcccgtattatcct
ccgtcaattagtaatttaggcttggatgaggataaaccagtgattttgagtttgtatcca
aatcctgtttctaatcagttgtttttgaatctgagcttgccgtacactggtcaaacatct
tttgaattgattgatggattaggacatttgattcctttgagaagtgagaacattcagctt
acgggatcgaatcaattcgcttttgatttttcaaatattcctgctggatcttatattttg
agaattaataacaatggttcaatgattcaatctcaagtggttaaatactag

DBGET integrated database retrieval system