KEGG   Fluviicola taffensis: Fluta_1300Help
Entry
Fluta_1300        CDS       T01455                                 

Definition
2-oxoglutarate dehydrogenase E2 (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
fte  Fluviicola taffensis
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:fte00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Fluta_1300
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Fluta_1300
  Amino acid metabolism
   00310 Lysine degradation
    Fluta_1300
Enzymes [BR:fte01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Fluta_1300
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1465863..1467146
Genome map
AA seq 427 aa AA seqDB search
MSILEMKVPSPGESISEVEIATWLVTDGDYVEKDQPIAEVDSDKATLELPAEQAGIITLK
AAEGDLVKVGQVVCLIDTSAERPAGSAAPTEAPKTEEKAPAAEKSVEATPVAEKTSAPVP
NPGPVSDSYAKGTPSPAAAKIMSENGVNGAKINGSGKDGRITKQDVVEAMAAGIPADATQ
GWGGTRDQNREKMSMLRRKIAERLVSVKNETAMLTTFNEVDMKPIMDLRAKYKDQFSKFH
EVNLGFMSFFTKAVTEALNLFPSVNAQIDGNEMIFHNYADIGIAVSSPKGLMVPVVRNAE
QMSLAEIEREIKRLAIKARDGKITPEDMTGGTFTITNGGVFGSMMSTPIINPPQSAILGM
HNIIERPVAIDGKVEIRPMMYLALSYDHRIIDGKESVGFLVKVKEMIENPERIIFGGKDP
YAVLLGL
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atgtcaatccttgaaatgaaagtacctagcccgggagaatcaatttctgaagtagaaatt
gcaacttggttagttacggatggtgactatgtagaaaaagaccagcctattgcagaagtt
gattctgacaaagcaacattggaattgccagcagaacaagcgggtattattactttgaaa
gcggcagaaggcgatttagtaaaagttggacaagttgtttgtttgatcgatacttcagct
gaaagaccagctggttcagcagctcctactgaagctccaaaaacagaagagaaagcacct
gcggctgagaaaagtgttgaagctactcccgttgcagaaaaaacaagtgctccagttcct
aacccagggcctgtaagtgatagttatgcgaaaggaacgccttcaccagcagcagcaaaa
atcatgtctgaaaacggtgtaaatggagctaaaataaatggttctggaaaagacggtcgc
attacgaaacaagacgttgttgaagcaatggcagcaggaattcctgctgatgctactcaa
ggatggggaggaacacgcgatcaaaatcgcgagaaaatgtccatgcttcgtcgcaagata
gctgagcgtttggtatctgttaagaacgaaacagccatgttgactacattcaatgaggtt
gacatgaaaccaataatggatttacgtgcgaagtacaaggatcaattctctaaattccac
gaagtgaatttaggattcatgtctttcttcacgaaagctgtaactgaagcattgaatttg
ttcccatcagtgaatgcacaaattgatggaaatgagatgattttccacaactacgcagat
attggtatcgcagtttcatctccaaaaggattaatggttccggttgttcgcaatgcagaa
caaatgagtttggctgaaattgagcgagaaatcaaacgtctagctattaaagctcgtgac
ggaaaaattactccagaagatatgactggtggaacatttacgattaccaatggtggtgta
tttggttcaatgatgtcaactccaatcatcaatcctccacaatctgctattttgggaatg
cacaatattattgagcgccctgtagcaattgatggtaaagtggagattcgtccgatgatg
tatttagcattgtcttacgatcaccgaattatcgacggaaaagaatctgtaggattctta
gtaaaagtgaaagaaatgattgaaaatcctgaaagaattatcttcggaggaaaagaccct
tatgcggtacttctaggattgtaa

DBGET integrated database retrieval system