KEGG   Fluviicola taffensis: Fluta_1344Help
Entry
Fluta_1344        CDS       T01455                                 

Definition
uroporphyrinogen-III synthase (EC:4.2.1.75)
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
fte  Fluviicola taffensis
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:fte00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1519683..1520432)
Genome map
AA seq 249 aa AA seqDB search
MSIKTILVSQPKPEGEKSPYFDLAEKYKLKIDFRPFIHVEGVSVQEFRTHKIDLKEHTAV
ILTSKTAVDHFFRISEETRFEVPDTMKYFCISEAVALYLQKYVTYRKRKIFFGKQTIEEL
VDPIKKHKGEKFLLPCTDILQDKIPLTLEDAKIPFTKAMLYRTVASDLSDLEDVYYDMLV
FFSPGGIESLFKNFPDFKQNKTLIAAFGPTTANAVVKNNLRLDVHAPMPNAPSMTAAIEN
FIKDHNKKK
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
ttgagtattaaaacaattttggtttctcaaccaaagccggaaggcgagaaatcaccgtat
tttgatttggccgaaaagtataagttgaaaatagatttcaggccgtttattcatgtagaa
ggtgtttccgttcaggaattccgaacacataaaatagacctaaaagaacatactgctgtc
attcttacttcaaaaaccgcggtagatcatttttttcgtatttcagaagaaacacgtttc
gaagttcctgatacaatgaagtatttctgtatttctgaggctgtagcactttacttacag
aagtatgtaacttatcgcaagcgtaaaattttctttggaaaacaaacgattgaagaatta
gtagatccaatcaaaaaacacaaaggcgaaaagtttttgcttccgtgtaccgatatttta
caagataaaattccattaacattagaagatgctaaaattccgtttactaaagcaatgtta
tacagaacagtagcttcggatttaagtgatttggaagatgtttactatgatatgttggtt
ttctttagtcctggaggaattgaaagtttattcaaaaatttccctgatttcaaacaaaat
aaaacattaattgctgcatttggtccaactacggcaaatgccgtggtgaaaaataatttg
agattagatgttcatgccccaatgccaaacgcaccaagtatgaccgctgctattgagaat
tttataaaagatcataataagaagaagtga

DBGET integrated database retrieval system