KEGG   Fluviicola taffensis: Fluta_1456Help
Entry
Fluta_1456        CDS       T01455                                 

Definition
(GenBank) Uroporphyrinogen III synthase HEM4
  KO
K01719  uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
fte  Fluviicola taffensis
Pathway
fte00860  Porphyrin and chlorophyll metabolism
fte01100  Metabolic pathways
fte01110  Biosynthesis of secondary metabolites
fte01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:fte00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Fluta_1456
Enzymes [BR:fte01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     Fluta_1456
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4
Motif
Other DBs
NCBI-ProteinID: AEA43450
UniProt: F2IEC6
Position
complement(1644951..1645616)
Genome map
AA seq 221 aa AA seqDB search
MTRIFLSSESNSSLPVVQFCTENNIQLIRRSLISFKAIDFSLPSEWDVVFFSSPRSFDFF
CKRGLHLEENQQIACIGNETKNQIEKAGFSVSFVGQEAGKPSEVGIAFKEWLGKRIALFP
QSNKSNKSVEKSISESLRIPLLVYETVNSSSKIDWCSVYIFTSPSNLTSFLLENKIPKNA
IIIAWGETTNELMLSLGYQSTLVLNTSSYHELIEILPTLIA
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
atgacgaggatatttcttagttcggaaagcaattcatccttaccagtagttcagttttgt
actgaaaacaacattcaattaatccgccgatcacttatttctttcaaagctattgatttt
tcacttccttccgaatgggatgttgttttcttcagttcaccccgatcttttgattttttt
tgtaaacgaggtcttcatttagaggagaatcagcaaattgcatgtataggcaatgaaact
aaaaatcaaattgaaaaagctggattttctgtcagttttgtcggtcaagaagctggaaaa
ccaagtgaagtaggaattgcatttaaagaatggcttggaaagagaatagccttgtttcct
caatctaataaatccaataaatcggttgaaaaatcaatatcggaatcgttgcgaattcct
ttattggtctacgaaacagtcaattctagttcaaaaattgattggtgttcggtttatatt
ttcactagtccttctaatttaactagtttcttacttgaaaacaaaattcctaaaaatgct
ataattattgcttggggagaaactaccaatgaattgatgttgagtcttggttatcaatcg
actttggttttaaatacctcgagctatcacgagcttattgagattcttccgacattaata
gcttaa

DBGET integrated database retrieval system