KEGG   Fluviicola taffensis: Fluta_1486Help
Entry
Fluta_1486        CDS       T01455                                 

Definition
(GenBank) aminopeptidase (EC:3.2.1.4)
Organism
fte  Fluviicola taffensis
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1678614..1679657)
Genome map
AA seq 347 aa AA seqDB search
MNKKLLAEICKTPGAPGHEDRVRKLVLREIESLCDEVEVDNMGNVYAIRKGKSNKSVMVG
AHMDEIGFMVTYIDDKGFIRFTTLGGFDPKTLTAQRVIIHGKEDVIGVMASKPIHVMTQD
ERNKVAKLSDYFVDTGLPAEKVKELVSIGDVITREREFIEMGDCFNSKSLDNRLAVFIAI
EVLKLLKGKELPNDVYMVFTVQEEVGIRGANVASLNIKPFFGFGLDTTIAFDLPGAAAHE
QITKLGEGTAIKIMDASTICDPRMVRYMKEVADRNKIKWQPEILTAGGTDTAGIQRMSPG
GSIAGAVSIPTRHLHQVIEMAHKDDIQASIDLLASCLLELNQFNLEY
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgaataaaaagctcttagcagaaatatgtaaaacgcctggtgctcctggacatgaggat
agagttcgaaaattggttttacgggaaattgaatcactgtgtgatgaggtagaggtggat
aacatgggaaatgtgtatgcaattcgtaaaggaaaatcgaacaaaagtgtcatggttgga
gcccacatggatgaaattggtttcatggtcacttatattgatgacaaagggtttatccgt
ttcactactttgggtggatttgatccgaaaacattgactgctcagcgcgtaattattcat
ggaaaagaagatgtaatcggagtaatggcttcaaaacccattcacgtcatgacacaagat
gagcgaaataaagtcgcaaaactctcagattattttgtagatacgggcttacctgctgaa
aaagtgaaagaattggtttctattggagatgtgattactcgagagagggaatttatcgag
atgggagattgtttcaattcgaaatcattggataatcgattggcagttttcatcgctatt
gaggtgttgaaattgttgaaaggaaaagaacttcccaatgacgtgtacatggttttcacc
gtacaagaagaagttggaatccgtggtgcaaacgtggctagtttgaatatcaagccattc
ttcggatttggattggatacaacgattgcttttgatttaccgggagctgctgctcatgaa
caaatcaccaaattgggtgaaggaactgccattaagattatggatgcttctacgatttgt
gatccgagaatggtgcgttatatgaaagaagttgctgatagaaataaaatcaaatggcaa
cctgaaattttaactgctggtggaacagatacggctggaattcagcgaatgtcgccaggg
ggatcaatcgctggtgcggtttctatcccaacccgacatttacatcaagtgattgaaatg
gcgcacaaagacgatattcaggcaagtattgatttactggcttcatgtttgttagagctg
aatcaatttaatttagaatattaa

DBGET integrated database retrieval system